Recombinant Mouse CD14 Protein
Beta LifeScience
SKU/CAT #: BLA-10849P
Recombinant Mouse CD14 Protein
Beta LifeScience
SKU/CAT #: BLA-10849P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P10810 |
Synonym | CD 14 CD_antigen=CD14 CD14 CD14 antigen CD14 molecule CD14_HUMAN LPS-R Mo2 Monocyte differentiation antigen CD14 Monocyte differentiation antigen CD14 urinary form Monocyte differentiation antigen CD14, membrane-bound form Myeloid cell specific leucine rich glycoprotein Myeloid cell-specific leucine-rich glycoprotein |
Description | Recombinant Mouse CD14 Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYL LKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQ ELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLK PGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPL KFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPS CDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQV GNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLF VHHHHHH |
Molecular Weight | 38 kDa including tags |
Purity | >90% SDS-PAGE.Purified by using conventional chromatography techniques. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |