Recombinant Mouse CD21 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10916P
Recombinant Mouse CD21 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10916P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P19070 |
Synonym | C3DR CD 21 CD21 Complement C3d receptor Complement C3d receptor 2 Complement component (3d/Epstein Barr virus) receptor 2 Complement receptor type 2 CR Cr2 CR2_HUMAN CVID7 EBV receptor EBV-R Epstein Barr virus receptor Epstein-Barr virus receptor EVBR SLEB9 |
Description | Recombinant Mouse CD21 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQ VHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCK ANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
Molecular Weight | 19 kDa including tags |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Receptors of complement activation (RCA) family |
Database References | STRING: 10090.ENSMUSP00000080938 UniGene: Mm.235387 |
Tissue Specificity | B-lymphocytes. |