Recombinant Mouse CD3 epsilon/CD3E Protein (His tag)

Name: Recombinant Mouse CD3 epsilon/CD3E Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-10952P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P22646
Synonym	CD3 epsilon CD3e CD3e antigen CD3E antigen epsilon polypeptide CD3e antigen epsilon polypeptide (TiT3 complex) CD3E antigen, epsilon subunit CD3e molecule epsilon CD3e molecule, epsilon (CD3 TCR complex) CD3e molecule, epsilon (CD3-TCR complex) CD3E_HUMAN IMD18 T cell antigen receptor complex epsilon subunit of T3 T cell surface antigen T3/Leu 4 epsilon chain T cell surface glycoprotein CD3 epsilon chain T-cell surface antigen T3/Leu-4 epsilon chain T-cell surface glycoprotein CD3 epsilon chain T3E TCRE
Description	Recombinant Mouse CD3 epsilon/CD3E Protein (His tag) was expressed in Yeast. It is a Protein fragment
Source	Yeast
AA Sequence	DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDF SEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Molecular Weight	12 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	KEGG: mmu:12501 STRING: 10090.ENSMUSP00000099896 UniGene: Mm.210361

Gene Functions References

The data show that CD3epsilon chain couples to Cbl via simultaneous binding of both proteins to Numb, thus mediating TCR degradation PMID: 26507128
IL-17-producing CD3(bright) gammadelta T cells responded promptly and strongly to pneumococcal infection and during skin inflammation. PMID: 25385067
these results suggest that CD3zeta can be degraded by two pathways: SLAP/c-Cbl, which targets internalized cell surface CD3zeta dependent on TCR signaling, and LAPTM5, which targets intracellular CD3zeta independent of TCR signaling. PMID: 24638062
these results indicate that membrane association of the CD3epsilon signaling domain is required for optimal thymocyte development and peripheral T cell function. PMID: 24899501
These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppression PMID: 24595757
that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
Structure of murine CD3epsilon complexed with the mitogenic anti-CD3epsilon antibody 2C11 enabled structural comparisons of antibody-liganded and unliganded forms of CD3epsilon revealing that antibody binding does not induce any substantial rearrangements within CD3epsilon. PMID: 22262845
CFTR dysfunction in T cells can lead directly to aberrant immune responses in CD3+ lymphocytes PMID: 20724552
analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
Polymorphisms of the CD3varepsilon ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID: 20638133
the stalks of the CD3 proteins may be critical in transmitting part of the activation signal directly through the membrane. PMID: 19956738
Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
We demonstrate that the intra-cytoplasmic (IC) domain of CD3epsilon plays a critical role in regulating TCR expression on DP thymocytes. PMID: 19819936
inability of Nck to bind to the CD3epsilon proline-rich sequence in thymocytes after TCR ligation PMID: 15972658
That CD43 costimulation was responsible for elevated cytokine/chemokine activity was confirmed at the transcriptional level by real-time PCR for IFN-gamma and CCL5, and by ELISA for IFN-gamma. PMID: 16246302
insulin-specific Tregs producing IL-10, TGF-beta, and IL-4 are enhanced by suppression of CD3epsilon in a mouse model of autoimmune diabetes PMID: 16628253
GRK2 is primarily involved in arresting G protein-coupled receptor signals, its interaction with CD3 epsilon may provide a novel means whereby the TCR can negatively regulate signals generated through G protein-coupled receptors. PMID: 17420248
FcgammaRIIB, a low-affinity immunoglobulin G Fc receptor, and CD3 are involved in cerebellar functions. PMID: 17502348
CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
mouse CD3 epsilon chains N-terminal charged residues have roles in generating isoforms modulating antigen T cell receptor-mediated signals and T cell receptor-CD3 interactions PMID: 17561508
CD3epsilon proline-rich sequence amplifies weak TCR signals by promoting synapse formation and CD3epsilon phosphorylation PMID: 18566390
have identified distinct roles for individual motifs of CD3epsilon in the preTCR-mediated differentiation and proliferation PMID: 19342663
functional role for the CD3 epsilon lipid-binding domain in T cell biology PMID: 19542373
importance of the conformational change in CD3epsilon for the activation of T cells PMID: 19671929

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.