Recombinant Mouse CD3 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10946P
Recombinant Mouse CD3 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10946P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P22646 |
Synonym | 4930549J05Rik A430104F18Rik AW552088 Cd247 CD247 antigen CD247 antigen, zeta subunit CD247 molecule CD3 CD3 antigen, delta subunit CD3 delta CD3 epsilon CD3 eta CD3 gamma CD3 molecule delta polypeptide CD3 molecule, epsilon polypeptide CD3 molecule, gamma polypeptide CD3 zeta CD3-DELTA CD3d CD3D antigen delta polypeptide CD3d antigen, delta polypeptide (TiT3 complex) CD3d molecule delta CD3d molecule delta CD3 TCR complex CD3d molecule, delta (CD3-TCR complex) CD3D_HUMAN CD3E CD3e antigen CD3E antigen epsilon polypeptide CD3e antigen, epsilon polypeptide (TiT3 complex) CD3e molecule epsilon CD3e molecule epsilon CD3 TCR complex CD3e molecule, epsilon (CD3-TCR complex) CD3epsilon CD3G CD3g antigen CD3G antigen gamma polypeptide CD3g antigen, gamma polypeptide (TiT3 complex) CD3g molecule gamma CD3g molecule gamma CD3 TCR complex CD3g molecule, gamma (CD3-TCR complex) CD3H CD3Q CD3Z CD3zeta Ctg3 FLJ17620 FLJ17664 FLJ18683 FLJ79544 FLJ94613 IMD19 Leu-4 MGC138597 OKT3, delta chain OTTHUMP00000032544 T cell receptor T cell receptor T3 delta chain T cell receptor T3 gamma chain T cell receptor T3 zeta chain T cell receptor zeta chain T cell surface antigen T3/Leu 4 epsilon chain T cell surface glycoprotein CD3 T cell surface glycoprotein CD3 delta chain T cell surface glycoprotein CD3 epsilon chain T cell surface glycoprotein CD3 gamma chain T cell surface glycoprotein CD3 zeta chain T-cell antigen receptor complex, delta subunit of T3 T-cell antigen receptor complex, epsilon subunit of T3 T-cell antigen receptor complex, gamma subunit of T3 T-cell antigen receptor complex, zeta subunit of CD3 T-cell receptor T3 delta chain T-cell receptor T3 gamma chain T-cell surface antigen T3/Leu-4 epsilon chain T-cell surface glycoprotein CD3 delta chain T-cell surface glycoprotein CD3 epsilon chain T-cell surface glycoprotein CD3 gamma chain T3 T3d T3e T3g T3z TCRE TCRk Tcrz TCRzeta |
Description | Recombinant Mouse CD3 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDF SEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD |
Molecular Weight | 36 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References |
Gene Functions References
- The data show that CD3epsilon chain couples to Cbl via simultaneous binding of both proteins to Numb, thus mediating TCR degradation PMID: 26507128
- IL-17-producing CD3(bright) gammadelta T cells responded promptly and strongly to pneumococcal infection and during skin inflammation. PMID: 25385067
- these results suggest that CD3zeta can be degraded by two pathways: SLAP/c-Cbl, which targets internalized cell surface CD3zeta dependent on TCR signaling, and LAPTM5, which targets intracellular CD3zeta independent of TCR signaling. PMID: 24638062
- these results indicate that membrane association of the CD3epsilon signaling domain is required for optimal thymocyte development and peripheral T cell function. PMID: 24899501
- These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppression PMID: 24595757
- that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
- Structure of murine CD3epsilon complexed with the mitogenic anti-CD3epsilon antibody 2C11 enabled structural comparisons of antibody-liganded and unliganded forms of CD3epsilon revealing that antibody binding does not induce any substantial rearrangements within CD3epsilon. PMID: 22262845
- CFTR dysfunction in T cells can lead directly to aberrant immune responses in CD3+ lymphocytes PMID: 20724552
- analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
- Polymorphisms of the CD3varepsilon ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID: 20638133
- the stalks of the CD3 proteins may be critical in transmitting part of the activation signal directly through the membrane. PMID: 19956738
- Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
- We demonstrate that the intra-cytoplasmic (IC) domain of CD3epsilon plays a critical role in regulating TCR expression on DP thymocytes. PMID: 19819936
- inability of Nck to bind to the CD3epsilon proline-rich sequence in thymocytes after TCR ligation PMID: 15972658
- That CD43 costimulation was responsible for elevated cytokine/chemokine activity was confirmed at the transcriptional level by real-time PCR for IFN-gamma and CCL5, and by ELISA for IFN-gamma. PMID: 16246302
- insulin-specific Tregs producing IL-10, TGF-beta, and IL-4 are enhanced by suppression of CD3epsilon in a mouse model of autoimmune diabetes PMID: 16628253
- GRK2 is primarily involved in arresting G protein-coupled receptor signals, its interaction with CD3 epsilon may provide a novel means whereby the TCR can negatively regulate signals generated through G protein-coupled receptors. PMID: 17420248
- FcgammaRIIB, a low-affinity immunoglobulin G Fc receptor, and CD3 are involved in cerebellar functions. PMID: 17502348
- CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
- mouse CD3 epsilon chains N-terminal charged residues have roles in generating isoforms modulating antigen T cell receptor-mediated signals and T cell receptor-CD3 interactions PMID: 17561508
- CD3epsilon proline-rich sequence amplifies weak TCR signals by promoting synapse formation and CD3epsilon phosphorylation PMID: 18566390
- have identified distinct roles for individual motifs of CD3epsilon in the preTCR-mediated differentiation and proliferation PMID: 19342663
- functional role for the CD3 epsilon lipid-binding domain in T cell biology PMID: 19542373
- importance of the conformational change in CD3epsilon for the activation of T cells PMID: 19671929