Recombinant Mouse CD30 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10628P
Recombinant Mouse CD30 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10628P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-t cell therapy targets, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q60846 |
Synonym | CD 30 CD30 CD30 antigen CD30L receptor Cytokine receptor CD30 D1S166E KI 1 KI 1 antigen Ki-1 antigen KI1 Lymphocyte activation antigen CD30 TNFRSF 8 Tnfrsf8 TNR8_HUMAN Tumor necrosis factor receptor superfamily member 8 |
Description | Recombinant Mouse CD30 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | FPTDRPLKTTCAGDLSHYPGEAARNCCYQCPSGLSPTQPCPRGPAHCRKQ CAPDYYVNEDGKCTACVTCLPGLVEKAPCSGNSPRICECQPGMHCCTPAV NSCARCKLHCSGEEVVKSPGTAKKDTICELPSSGSGPNCSNPGDRKTLTS HATPQAMPTLESPANDSARSLLPMRVTNLVQEDATELVKVPESSSSKARE PSPDPGNAEKNMTLELPSPGTLPDISTSENSKEPASTASTLSLVVDAWTS SRMQPTSPLSTGTHHHHHH |
Molecular Weight | 28 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |