Recombinant Mouse CD36 Protein
Beta LifeScience
SKU/CAT #: BLA-10982P
Recombinant Mouse CD36 Protein
Beta LifeScience
SKU/CAT #: BLA-10982P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q08857 |
Synonym | Adipocyte membrane protein BDPLT10 CD36 CD36 antigen CD36 antigen (collagen type I receptor, thrombospondin receptor) CD36 molecule CD36 molecule (thrombospondin receptor) CD36_HUMAN CHDS7 Cluster determinant 36 Collagen receptor, platelet FAT Fatty acid translocase Fatty acid transport protein Glycoprotein IIIb GP IIIb GP3B GP4 GPIIIB GPIV Leukocyte differentiation antigen CD36 MGC108510 MGC91634 PAS 4 protein PAS IV PAS-4 PASIV Platelet collagen receptor Platelet glycoprotein 4 Platelet glycoprotein IV scarb3 Scavenger receptor class B member 3 SR-B3 SRB3 Thrombospondin receptor |
Description | Recombinant Mouse CD36 Protein was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | ADPGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFWIFDVQNPDDV AKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSL SVGTEDDNFTVLNLAVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLK ELLWGYKDPFLSLVPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAI IESYKGKRNLSYWPSYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIY AVFGSEIDLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYG VLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPI TGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEK AEMFKTQVTGKIKHHHHHH |
Molecular Weight | 47 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |