Recombinant Mouse CD83 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11100P
Recombinant Mouse CD83 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11100P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O88324 |
Synonym | B cell activation 45kDa cell surface glycoprotein Ig superfamily B cell activation protein B-cell activation protein BL11 BL11 PEN CD83 CD83 antigen CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule CD83_HUMAN Cell surface glycoprotein Cell surface protein HB15 HB15 hCD83 |
Description | Recombinant Mouse CD83 Protein (Fc Tag) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNS SFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCP KEATESTFRKYRAE |
Molecular Weight | 13 kDa |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. |