Recombinant Mouse CD86 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-11106P

Recombinant Mouse CD86 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-11106P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P42082
Synonym Activation B7-2 antigen Activation B7-2 antigen 3 B-lymphocyte activation antigen B7-2 B-lymphocyte activation antigen B7-2 2 B7 B7 2 B7-2 B7.2 B70 B72 B72 antigen BU63 CD28 antigen ligand 2 CD28 antigen ligand 2 2 Cd28l2 CD28LG2 CD86 CD86 antigen CD86 antigen (CD28 antigen ligand 2 B7 2 antigen) CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) 1, 2 CD86 molecule CD86_HUMAN CLS1 CTLA-4 counter-receptor B7.2 CTLA-4 counter-receptor B7.2 2 CTLA-4 counter-receptor B7.2 2, 3 Early T-cell costimulatory molecule 1 ETC-1 FUN 1 FUN-1 FUN1 LAB72 Ly-58 Ly58 MB7 MB7-2 Membrane glycoprotein MGC34413 T lymphocyte activation antigen CD86 precursor T-lymphocyte activation antigen CD86 TS/A-2
Description Recombinant Mouse CD86 Protein (His tag) was expressed in Mammalian. It is a Protein fragment
Source Mammalian
AA Sequence VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTE KLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIIL QQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLI TNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESM KISSKPLNFTQEFPSPQTYWKHHHHHH
Molecular Weight 26 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C long term.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed