Recombinant Mouse CD90 / Thy1 Protein

Name: Recombinant Mouse CD90 / Thy1 Protein
Brand: Beta LifeScience
SKU: BLA-11114P
Availability: InStock

Collections: Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P01831
Synonym	CD7 CD90 CD90 antigen CDw90 FLJ33325 MGC128895 T25 Theta antigen Thy 1 Thy 1 cell surface antigen Thy 1 membrane glycoprotein Thy 1 T cell antigen Thy 1.2 Thy-1 antigen Thy-1 membrane glycoprotein Thy1 Thy1 antigen Thy1 T cell antigen Thy1.1 Thy1.2 THY1_HUMAN Thymus cell antigen 1, theta
Description	Recombinant Mouse CD90 / Thy1 Protein was expressed in HEK293. It is a Full length protein
Source	HEK293
AA Sequence	QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLG IPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNK SISVYRDKLVKC
Molecular Weight	48 kDa
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle.

Target Details

Target Function	May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Database References	KEGG: mmu:21838 STRING: 10090.ENSMUSP00000110489 UniGene: Mm.3951

Gene Functions References

Molecular characterization of Thy1 expressing fear-inhibiting neurons within the basolateral amygdala identify and validate Ntsr2-expressing neurons as a putative 'Fear-Off' population. PMID: 27767183
Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1. PMID: 28165468
Thy-1 in CECs regulates VEGF-induced CEC activation and migration and links extracellular 7-KC to intracellular signaling. PMID: 27768790
lincRNA-p21 overexpression dramatically inhibited acetylation of H3 and H4 at the Thy-1 promoter and Thy-1 expression levels in HLF1 cells. Finally, lincRNA-p21 interference rescued LPS-induced increase of lung and BAL collagen contents. LincRNA-p21 could lead to pulmonary fibrosis in ARDS by inhibition of the expression of Thy-1. PMID: 27392907
The changes in CD90 and CD105 expression in the testis and ovary of mice are reported. PMID: 26679159
Suggest that TGF-beta1 epigenetically regulates lung fibroblast phenotype through methylation of the Thy-1 promoter. PMID: 26333597
Thy-1 facilitates the recruitment of membrane raft-residing signaling molecules such as Fyn kinase and the SFK regulator, Csk binding protein (Cbp), to focal adhesions via its direct coupling of integrins and raft domains. PMID: 26459603
Thy-1 has an important role in controlling cell proliferation and cell differentiation in dermal fibroblasts. PMID: 25739049
TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells. PMID: 25070848
results indicate that CD90/Thy-1 is expressed on lymphatic endothelial cells and represents a suitable marker for murine lung lymph vessels PMID: 23408960
Thy1-expressing subpopulation of basolateral amygdala pyramidal neurons provide an important molecular and pharmacological target for inhibiting fear PMID: 23785152
These data suggest that blocking Thy-1 at wound areas using siRNA reduces repair and affects the re-epithelialization and over-expression of TGF-beta1 of the wound during the skin healing process. PMID: 23312577
Thy-1 promoter becomes methylated in hypoxic fibroblasts resulting in reduced gene expression and activation of myofibroblast phenotype. PMID: 22938014
Astrocytic alphaVbeta3 integrin inhibits neurite outgrowth and promotes retraction of neuronal processes by clustering Thy-1 PMID: 22479590
Thy-1 promoted lipofibroblast differentiation via the expression of PPARgamma, stimulated lipid accumulation via fatty-acid esterification, and enhanced the fatty-acid uptake mediated by fatty-acid transporter proteins PMID: 22268140
data suggest THY1 plays a role in cell adhesion via binding to integrin beta3 in ovaries; THY1 may be involved in cell-cell adhesion during formation of theca cell layer; induced of THY1 in ovaries may be affected by follicle stimulating hormone PMID: 21228213
During acute lung inflammation, the extravasation of eosinophils and monocytes into the lung was significantly reduced in Thy-1-deficient mice. PMID: 21264853
The machinery of NE/cAMP modulation of Thy-1 mRNA decay involves a cAMP responsive ARE in its 3' UTR and multiple site specific ARE binding proteins. PMID: 20412850
Thy1 is a novel lymphatic vessel expressed gene, and has a potential role in the cell adhesion processes required for tumor progression and inflammation PMID: 20599951
Findings suggest that Thy-1 down-regulates TNF-alpha-activated gene expression via interfering with SFK- and NF-kappaB-mediated transactivation. PMID: 20657842
Thy-1-integrin alpha(v)beta(5) interactions inhibit contraction-induced latent TGF-beta1 activation, presumably by blocking the binding of extracellular matrix-bound latent TGF-beta1 with integrin alpha(v)beta(5). PMID: 20463011
visual signals derived from the rat ChR2-expressing retinal ganglion cells under the control of a mouse Thy-1.2 promotor are reinterpreted by the brain to form behavior-related vision PMID: 19893752
CBP plays a role in transiently anchoring Thy-1 to the cytoskeleton. PMID: 19825940
Thy-1 triggering can partially substitute for signal 1 for T cell activation which, in combination with a strong signal 2, leads to robust T cell proliferation and IL-2 synthesis but does not induce cytolytic function. PMID: 12816984
results indicate that alphaX-beta2 specifically interacts with Thy-1 PMID: 15850796
Thy-1 signalling promotes the in vitro generation of CTL that kill in a granule-dependent fashion PMID: 16033530
Loss of fibroblast Thy-1 expression correlates with lung fibrogenesis PMID: 16049324
CD44(+) CD90(+) cells have the ability to generate neurospheres and to form vascular tubes PMID: 16962069
Thy-1 positive cells have 4-8 times higher potential to show neuron-like morphology and differentiation than Thy-1 negative cells. PMID: 17006052
Thus, CD90(+) cells are a newly identified additional cell fraction that increased during skeletal muscle regeneration in vivo and could be another cell source for therapy for lama2-deficient muscular dystrophy. PMID: 17963748
Epigenetic regulation of Thy-1 is a novel and potentially reversible mechanism in fibrosis that may offer the possibility of new therapeutic options PMID: 18556592
loss of Thy1 can influence the dopaminergic profile in the striatum PMID: 18615641
Thy1 in myofibroblasts is not just a marker, but is a functional protein that transmits signals into the cell, up-regulating its FasL expression. PMID: 18676775
Hypoxia, by reducing Thy-1, increases TGF-beta activation, and thereby inhibits normal alveolar development. PMID: 19270178

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.