Recombinant Mouse Complement C4-B (C4B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01053P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Complement C4-B (C4B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01053P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Complement C4-B (C4B) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P01029 |
Target Symbol | C4B |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV |
Expression Range | 1448-1738aa |
Protein Length | Partial |
Mol. Weight | 39.0 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Non-enzymatic component of C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. Catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens. |
Subcellular Location | Secreted. Cell junction, synapse. Cell projection, axon. Cell projection, dendrite. |
Database References |
Gene Functions References
- These data show that Borrelia burgdorferi OspC inhibits the classical and lectin complement pathways and competes with complement protein C2 for C4b binding. PMID: 28873507
- C4 mediated synapse elimination during postnatal development PMID: 26814963
- role in suppressing autoantibody production elicited by S. pneumoniae antigens PMID: 25339671
- a deficiency in C4b does not alter radiation-induced lung disease in the C57BL/6 mouse model PMID: 23259761
- C4 modulates interstitial inflammation in experimental glomerulonephritis. PMID: 11726230
- Complement C4 provides an important protective role against the development of systemic lupus erythematosus. PMID: 11801636
- identified the murine follicular dendritic cell marker, FDC-M2, as complement c4. FDC-M2 was detectable at sites of immune complex-mediated inflammatory disease PMID: 12115608
- C4 normally helps prevent early stages of autoimmune disease and that C4 deficiency predisposes to abnormal regulation of autoreactive B cells. PMID: 12207352
- Macrophages derived from bone marrow produce sufficient C4 protein to restore the humoral response to NP-KLH hapten in C4-deficient animals when administered along with thymus-dependent antigen. PMID: 12421924
- effects of complement depletion and deficiencies of C4, C5, and complement receptors 1 and 2 on mouse survival after intravenous exposure to S aureus PMID: 15192652
- We found that deletion of the C4 gene does not significantly change either the time of onset or the severity and tempo of myelin oligodendrocyte-induced EAE compared with controls with a fully intact complement system. PMID: 15390104
- In comparison with C57BL/6 mice, MRL/1pr mice had depressed C4 levels as early as 3 weeks of age. PMID: 17971229
- The increased mortality of C4(-/-) or Factor B(-/-) mice indicates that these two pathways of complement activation are required for survival in mousepox. PMID: 19112490
- Increased transcription of the complement C4 gene in the Rag1(-/-) intestine. PMID: 19200601