Recombinant Mouse EG-VEGF Protein
Beta LifeScience
SKU/CAT #: BLA-1343P
Recombinant Mouse EG-VEGF Protein
Beta LifeScience
SKU/CAT #: BLA-1343P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q14A28 |
Synonym | Black mamba toxin related protein EG VEGF EG-VEGF EGVEGF Endocrine-gland-derived vascular endothelial growth factor Mambakine PK1 PRK1 PROK1 PROK1_HUMAN Prokineticin 1 Prokineticin-1 |
Description | Recombinant Mouse EG-VEGF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | AVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPF LRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF |
Molecular Weight | 10 kDa |
Purity | >98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |