Recombinant Mouse Elastin (ELN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05140P

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Eln.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Eln.
Recombinant Mouse Elastin (ELN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05140P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Elastin (ELN) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P54320 |
Target Symbol | ELN |
Synonyms | ElnElastin; Tropoelastin |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG |
Expression Range | 266-443aa |
Protein Length | Partial |
Mol. Weight | 21.3 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Elastin family |
Database References |
Gene Functions References
- Data (including data from studies in mutant mice and cells from such mice) suggest that elastin-derived peptides are involved in regulation of lipid storage in hepatocytes; thus, elastin-derived peptides may play role in development and progression of non-alcoholic fatty liver. PMID: 29802129
- Elastin insufficiency triggers structural defects and abnormal remodeling of renal vascular signaling involving AT1R-mediated vascular mechanotransduction and renal hyperfiltration with increased blood pressure sensitivity to dietary sodium contributing to systolic hypertension. PMID: 28754555
- findings strongly suggested that elastin crosslinking and LOXL1 were co-associated with liver cirrhosis, while selective inhibition of LOXL1 arrested disease progression by reducing crosslinking of elastin. PMID: 29366776
- Elastin-Derived Peptides Promote Abdominal Aortic Aneurysm Formation by Modulating M1/M2 Macrophage Polarization PMID: 27183603
- mTOR-sensitive perturbation of smooth muscle cell mechanosensing contributes to elastin aortopathy. PMID: 28751568
- Deficient circumferential growth is the predominant mechanism for moderate obstructive aortic disease resulting from partial elastin deficiency in Williams syndrome. PMID: 28254817
- Elevations of whole lung HMGB1 level were associated with impaired alveolar development and aberrant elastin production in 85% O2-exposed newborn lungs. PMID: 26982166
- Eln was ubiquitously present, with enrichment in regions with cardiomyocyte differentiation, while there was an inverse correlation between ColI and cardiomyocyte differentiation. PMID: 25923353
- Lung histology revealed aberrant elastin production and impaired lung septation in oxygen-exposed lungs, while tropoelastin, integrin alphav, fibulin-1, fibulin-2 and fibulin-4 gene expression were elevated. PMID: 25428696
- Data suggest that expression of elastin in uterus, vagina, and bladder is down-regulated both in naturally aging mice and in mouse model of accelerated ovarian aging; such down-regulation may lead to pelvic floor disorders. PMID: 25131766
- These results suggest that elastin haploinsufficiency adversely impacts pulmonary angiogenesis. PMID: 25539853
- The increased levels of elastin, type V collagen and tenascin C are probably the result of increased expression by fibroblastic cells; reversely, elastin influences myofibroblast differentiation. PMID: 24291458
- Compared to control SMCs, the modulus of Eln-/- SMCs is reduced by 40%, but is unchanged in Fbln4-/- SMCs. The Eln-/- SMC modulus is rescued by soluble or alpha elastin treatment. PMID: 24322348
- Elastin haploinsufficiency impedes the progression of arterial calcification in MGP-deficient mice. PMID: 23857752
- Fstl1 is crucial for elastin expression and deposition in mesenchyme during lung alveologenesis PMID: 24282586
- Eln insufficiency induced hypertension is due to increased sensitivity of the resistance vasculature to circulating ANG II and to impaired endothelium-dependent vasodilatation. PMID: 24414067
- Two sides of MGP null arterial disease: chondrogenic lesions dependent on transglutaminase 2 and elastin fragmentation associated with induction of adipsin. PMID: 24036114
- tested the hypothesis that adhesive strength varies with atherosclerotic plaque composition of collagen and elastin in apoE and MMP12 knock outs PMID: 23261250
- Data show that tropoelastin staining was relatively weak in the ligamentum flavum from E15 through P0, P7 was the first stage that staining intensity was observed to be substantially stronger, intensity remained relatively high until P35. PMID: 22685574
- the C-terminal region of tropoelastin in has a critical role in elastic fiber assembly and suggest tissue-specific differences in the elastin assembly pat PMID: 22573328
- Macrophage-derived macrophage metalloelastase-12 regulates elastin degradation even in progressive experimental liver fibrosis. PMID: 22223197
- Genetic modifiers of cardiovascular phenotype caused by elastin haploinsufficiency act by extrinsic noncomplementation. PMID: 22049077
- Report accelerated fatigue-induced damage to or protease-related degradation of initially competent elastic elastin fibres in fibrillin-1 deficiency that renders arteries in Marfan syndrome increasingly susceptible to dilatation, dissection, and rupture. PMID: 21730037
- MMP-12 leads to elastin degradation in eosinophilic meningitis caused by Angiostrongylus cantonensis. PMID: 21856305
- Eln(+/-) mice have decreased aortic diameter and compliance in ex vivo tests that are significant by postnatal day 7 PMID: 21536846
- miR-29 and miR-15 family miRNAs are involved in the down-regulation of elastin in the adult aorta. PMID: 21305018
- Elastin degradation might be necessary but is not sufficient to induce arterial medial calcification. PMID: 21281809
- TGF-beta suppresses elastin degradation by inhibiting plasmin-mediated matrix metalloproteinase 9 activation. PMID: 21356372
- Oxidative and nitrosative modifications of tropoelastin prevent elastic fiber assembly. PMID: 20847053
- Elastin insufficiency in a mouse model establishes a role for elastin dysregulation in aortic valve pathogenesis. PMID: 20576933
- Elastin is only necessary for normal cardiovascular structure and function in mice starting in the last few days of fetal development. PMID: 20495146
- Data show that elastin induces actin stress fiber organization, inhibits proliferation, regulates migration and signals via a non-integrin, heterotrimeric G-protein-coupled pathway. PMID: 12466207
- tropoelastin has domains that mediate elastin deposition in vitro and in vivo PMID: 12626514
- Coordinately expressed and regulated with fibulin 5 in lung fibroblasts and may serve a key role during lung injury and repair. PMID: 12909585
- elastin gene product, signaling through the VGVAPG domain, directly induces VSMC myofibrillogenesis PMID: 14614988
- The mechanical behavior of ELN(+/-) arteries is likely due to the reduced elastin content combined with adaptive remodeling during vascular development PMID: 15863465
- Low levels of elastin is associated with pulmonary emphysema PMID: 17142349
- developed humanized elastin mouse with elastin production controlled by human elastin gene in bacterial artificial chromosome; expression pattern of human transgene mirrors endogenous murine gene PMID: 17626896
- Enhanced generation of elastin peptides in S100A4/Mts1 mice may promote increased viral entry in the vessel wall. PMID: 18083765
- Early elastin expression and organization modify arterial aging through their impact on both vascular cell physiology and structure. PMID: 18173368
- In MMP-9-deficient animals, vascular inflammation continued to develop, but the incidence of elastin breakdown was significantly reduced. Elastin breakdown in the coronary artery was virtually eliminated by ablation of MMP-9 PMID: 18311803
- LOXL1-KO lower urogenital tract anatomical and functional phenotype resembles female pelvic floor dysfunction in humans. Elastin disorganization may lead to such functional abnormalities. PMID: 18495804
- At atherosclerosis-susceptible vascular branch points, the absence of a luminal elastin barrier and the presence of a dense collagen/proteoglycan matrix contribute to increased retention of LDL PMID: 18506002
- Elastin insufficiency predisposes to elevated pulmonary circulatory pressures through changes in elastic artery structure. PMID: 18772328
- Reduced elastin in mice leads to adaptive remodeling, whereas the complete lack of elastin leads to pathological remodeling and death. PMID: 19372465