Recombinant Mouse EPO Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-1348P
Recombinant Mouse EPO Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-1348P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P07321 |
Synonym | EP EPO EPO alpha Epoetin Erythropoetin Erythropoietin precursor MVCD2 |
Description | Recombinant Mouse EPO Protein (Fc Tag) was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYA WKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAIS GLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLR GKLKLYTGEVCRRGDR |
Molecular Weight | 49 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | ED50 < 5 ng/ml as determined in a cell proliferation assay using Human TF-1 erythroleukemia cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |