Recombinant Mouse Fas Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-0220P

Recombinant Mouse Fas Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-0220P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P25446
Synonym ALPS 1A ALPS1A APO 1 Apo 1 antigen APO 1 cell surface antigen Apo-1 antigen APO1 Apo1 antigen APO1 cell surface antigen Apoptosis antigen 1 Apoptosis mediating surface antigen FAS Apoptosis-mediating surface antigen FAS APT 1 APT1 CD 95 CD 95 antigen CD95 CD95 antigen Delta Fas Delta Fas/APO 1/CD95 Delta Fas/APO1/CD95 Fas Fas (TNF receptor superfamily, member 6) FAS 1 FAS 827dupA Fas AMA FAS Antigen Fas cell surface death receptor FAS1 FASLG receptor FASTM sFAS Surface antigen APO1 TNF receptor superfamily, member 6 TNFRSF 6 TNFRSF6 TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6
Description Recombinant Mouse Fas Protein (His tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKM NGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNT KCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRHH HHHH
Molecular Weight 17 kDa including tags
Purity >95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed