Recombinant Mouse FGF17 Protein (His tag)

Name: Recombinant Mouse FGF17 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-1388P
Availability: InStock

Collections: Cytokines and growth factors, Enzymes, Growth factors and receptors, Kinase, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P63075
Synonym	FGF 13 FGF 17 FGF-17 FGF13 Fgf17 FGF17_HUMAN Fibroblast growth factor 17 HH20
Description	Recombinant Mouse FGF17 Protein (His tag) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGR RISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPS GKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQRE AHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQTLEHHH HHH
Molecular Weight	24 kDa including tags
Purity	>95% SDS-PAGE.Lyophilized from a 0.2 µm filtered solution.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C long term.

Target Details

Target Function	Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Subcellular Location	Secreted.
Protein Families	Heparin-binding growth factors family
Database References	KEGG: mmu:14171 STRING: 10090.ENSMUSP00000022697 UniGene: Mm.12814

Gene Functions References

Cre fate mapping in Fgf17 mutant embryos revealed novel functions of this gene in rostral patterning center progenitor development. Disruption resulted in aberrant progenitor number and distribution in the rostral telencephalon. PMID: 25889070
These results demonstrate that Fgf17 plays important roles in both the anatomical and functional development of the auditory midbrain PMID: 21356319
The expression from early streak stage to midgestation of Fgf17 is measured. It is closely related to Fgf8 (63.7% identical at the amino acid level). Fgf17 is expressed during gastrulation but at lower levels than Fgf8. PMID: 9651520
Fgf17 functions similar to Fgf8 in patterning the overall neocortical map PMID: 17442747
Fgf17 is required for several complex social behaviors and suggest that disturbances in Fgf17 signaling may contribute to neuropsychiatric diseases that affect such behaviors. PMID: 17908176

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.