Recombinant Mouse galectin 9/Gal-9 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-1997P
Recombinant Mouse galectin 9/Gal-9 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-1997P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O08573-2 |
Synonym | 36 kDa beta-galactoside-binding lectin Ecalectin Gal-9 galectin 9 Galectin-9 galectin9 HOM HD 21 HOMHD21 HUAT Lectin galactoside binding soluble 9 LEG9_HUMAN LGAL S9 LGALS 9 Lgals9 LGALS9A MGC117375 MGC125973 MGC125974 Tumor antigen HOM-HD-21 UAT Urate transporter/channel Urate transporter/channel protein |
Description | Recombinant Mouse galectin 9/Gal-9 Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMALFSAQSPYINPIIPFTGPIQGGLQE GLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQ NGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPY HLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFST PGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRC GGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWI ICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT |
Molecular Weight | 38 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |