Recombinant Mouse GDNF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1113P
Recombinant Mouse GDNF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1113P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P48540 |
Synonym | Astrocyte derived trophic factor Astrocyte derived trophic factor 1 Astrocyte-derived trophic factor Atf ATF 1 ATF 2 ATF1 ATF2 gdnf GDNF_HUMAN Glial cell derived neurotrophic factor Glial Cell Line Derived Neurotrophic Factor Glial cell line-derived neurotrophic factor Glial derived neurotrophic factor HFB1 GDNF hGDNF HSCR3 |
Description | Recombinant Mouse GDNF Protein (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLN VTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQ ACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Molecular Weight | 30 kDa |
Purity | >= 98% SDS-PAGE.Determined by reducing and Non-reducing SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The activity is determined by the dose-dependent proliferation of C6 cells and is typically less than 1 μg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |