Recombinant Mouse GRO gamma Protein
Beta LifeScience
SKU/CAT #: BLA-2277P
Recombinant Mouse GRO gamma Protein
Beta LifeScience
SKU/CAT #: BLA-2277P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q6W5C0 |
Synonym | C-X-C motif chemokine 3 C-X-C motif chemokine ligand 3 Chemokine (C X C motif) ligand 3 Chemokine (CXC motif) ligand 3 Cinc 2 CINC 2b Cinc2 CINC2b CXCL 3 Cxcl3 CXCL3_HUMAN Cytokine induced neutrophil chemoattractant 2 Dcip1 Dendritic cell inflammatory protein 1 Gm1960 GRO protein gamma GRO-gamma GRO-gamma(1-73) GRO-gamma(5-73) GRO3 GRO3 oncogene GROG Growth regulated protein gamma Growth-regulated protein gamma Macrophage inflammatory protein 2 beta precursor Macrophage inflammatory protein 2-beta Melanoma growth stimulatory activity gamma Member 3 MGSA gamma MIP 2b MIP2-beta MIP2B SCYB3 Small inducible cytokine subfamily B |
Description | Recombinant Mouse GRO gamma Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQS LTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Molecular Weight | 11 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References |
Gene Functions References
- The studies revealed that, although overall structural and oligomerization features of CXCL3 and CXCL2 are similar, prominent differences were observed in their surface characteristics, thus implicating a functional divergence. PMID: 28928065
- these results have indicated that CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. PMID: 27512010
- Tis21 induces migration of cerebellar granule neuron precursor cells through Cxcl3, which may represent a novel target for medulloblastoma therapy PMID: 23115191
- DCIP-1 interacts with chemokine CXCR2 and mediates human neutrophil chemotaxis, consistent with its role during the early proinflammatory phase of dendritic cell maturation. PMID: 14764687