Recombinant Mouse Growth-Regulated Alpha Protein (CXCL1) Protein (His)

Name: Recombinant Mouse Growth-Regulated Alpha Protein (CXCL1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08347P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Growth-Regulated Alpha Protein (CXCL1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P12850
Target Symbol	CXCL1
Synonyms	Cxcl1; Gro; Gro1; Mgsa; Scyb1Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51) [Cleaved into: KC(5-72; Hematopoietic synergistic factor; HSF; KC-T)]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Expression Range	29-96aa
Protein Length	Partial
Mol. Weight	11.5kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: mmu:14825 STRING: 10090.ENSMUSP00000031327 UniGene: Mm.21013

Gene Functions References

Data suggest that CD4+ T lymphocytes and microglial CD40 mediate their pro-nociceptive effects in part by promoting selected chemokine responses, and more importantly, CXCL1 can play an anti-nociceptive role in peripheral nerve injury-induced neuropathic pain, which is possibly mediated by infiltrating neutrophils. PMID: 29309879
Adipose stromal cells recruitment to tumours, driven by CXCL1 and CXCL8, promotes prostate cancer progression. PMID: 27241286
The results demonstrate that C57BL/6J mice have a functional defect in NLRP12, impaired CXCL1 production, and that macrophages require NLRP12 expression for effective recruitment of neutrophils to inflammatory sites. PMID: 27779193
GAG interactions and receptor activity of CXCL1 monomers and dimers are fine-tuned to regulate neutrophil trafficking for successful resolution of tissue injury. PMID: 27625115
a paracrine role for Hippo-mediated secretion of CXCL1 and CXCL2 in the production of anti-microbial peptides (beta-defensins), iNOS, NOX2 and pro-inflammatory molecules during mycobacterial infection of the host, is reported. PMID: 27883091
this study demonstrates that in vivo blocking of CXCL1 and CXCL2 can significantly reduce the Mycobacterium tuberculosis-induced bioactive IL-1beta production PMID: 28739876
CXCL1 contributed to rapid neutrophil recruitment during Bacillus cereus endophthalmitis. In CXCL1-knockout mice, retinal function was greater and neutrophil influx was less than in control mice, confirming its role in ocular inflammation. PMID: 27286792
Interferon-gamma (IFN-gamma) up-regulated interleukin 6 (IL-6) and CXCL1 chemokine (CXCL1) production of bone marrow mesenchymal stem cells (mBM-MSC). PMID: 28791835
Our work deciphers the mCXCL1-mTORC1 pathway as crucial in liver cancer stem cell maintenance PMID: 27488521
MMP7 shedding of syndecan-1/CXCL1 complexes functions as a checkpoint that restricts neutrophil activation at sites of epithelial injury. PMID: 26934670
Data show that loss of loss of matrix metalloproteinase-3 (MMP-3) repressed the upregulation of the chemokines monocyte chemoattractant protein (MCP)-1 and (C-X-C motif) ligand 1 (CXCL1). PMID: 27809288
The novel findings reveal the critical role of NLRP12-IL-17A-CXCL1 axis in host defense by modulating neutrophil recruitment against Klebsiella pneumoniae. PMID: 26349659
Nlrp12 deficiency caused increased neutrophil migration towards the chemokine CXCL1 and the neutrophil parasite Leishmania major, revealing NLRP12 as a negative regulator of directed neutrophil migration under these conditions. PMID: 26514298
Chemotactic activity of stellate cell-derived CXCL1 was assayed in vitro on neutrophils upon TLR4 activation. PMID: 27002851
IL-17RA regulates CXL-1 and 5 production in the lungs during the adaptive response. PMID: 26871571
Data suggest that CXCL1/IL-8, released from osteoclasts in an autoantibody-dependent manner, produces pain by activating sensory neurons. PMID: 26613766
TGF-beta negatively regulates CXCL1 expression in CAFs through Smad2/3 binding to the promoter, and through suppression of HGF/c-Met autocrine signaling PMID: 26252654
work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression PMID: 27049944
Repeated social defeat-induced VCAM-1 protein expression were localized to the vasculature of brain regions implicated in fear and anxiety responses. PMID: 25445193
In a chronic-binge ethanol-feeding model, the hepatic TLR2 and TLR9-dependent MyD88-dependent pathway mediates CXCL1 production, resulting in the development of alcohol-mediated liver injury. PMID: 25930080
IL-1 signaling plays a pivotal role in activating mucosal stromal cells to secrete CXCL1 which is essential for infiltration of IL-22-secreting neutrophils upon Citrobacter rodentium infection. PMID: 26034212
Zfp30 is expressed in airway epithelia in the normal mouse lung and Zfp30 expression in vitro affects CXCL1 responses to an immune stimulus. PMID: 25114278
Metoprolol also decreased serum levels of proinflammatory cytokines TNFalpha and CXCL1 and macrophage content in the plaques, showing that metoprolol has an anti-inflammatory effect. PMID: 25105129
This study demonstrated the role of peripheral CXCL1/CXCR2 signaling in postoperative pain in the setting of prior morphine exposure. PMID: 24887006
phagocytosis of refrigerator-stored RBCs in vivo induced increases in circulating monocyte chemoattractant protein-1 (MCP-1) and keratinocyte chemoattractant (KC) PMID: 25041478
Neutrophil recruitment and the neutrophil cytokines, CXCL1/CXCL2, were suppressed in apo(a)transgenic mice in the abdominal aortic aneurysm model. PMID: 24650562
These data identify a cytokine circuit that involves IL-1beta-induced production of CXCL1 and CXCL2 and leads the recruitment of neutrophils to streptococcal infection sites. PMID: 25114117
Estrogen receptors alpha regulates CCL20/CXCL1 secretion in the female reproductive tract. PMID: 23025258
These studies suggest that modulation of CXCL1 levels in tissues and blood could reduce bacterial burden in sepsis. PMID: 25172493
Pharmacological inhibition of NAMPT activity mitigates inflammation in atherosclerotic plaques by reducing CXCL1-mediated activities on neutrophils. PMID: 24196571
Data indicate that levels of toll-like receptors TLR4/4-stimulated chemokines CXCL1 and CXCL2 were selectively enhanced in stressed macrophages via receptor-interacting protein kinase 1 (RIPK1). PMID: 24920846
findings demonstrated that CXCL1 and CXCL5 are increased in circulation with onset of T2D, are produced by islets under stress, and synergistically affect islet function, suggesting that these chemokines participate in pathogenesis of T2D. PMID: 24928936
In vitro, neutrophils adherent to ICAM-1 or ICAM-2 rapidly released TNF in response to LTB4, C5a, and KC. PMID: 24913232
Secretion of Cxcl1 (KC) cytokine is inhibited by electrical stimulation in early and late experimentally induced arthritic spleen. PMID: 23791889
A sustained form of CXCL1 upregulation is demonstrated that can drive neuropathic pain in the spinal cord. PMID: 23831863
the presence of CXCL1 is required for recurrent Herpetic stromal keratitis as evidenced by the lack of corneal disease in mice treated with anti-CXCL1 Ab. PMID: 24442436
CXCL1 expressed by monocytes and CXCR2 on HBMEC is involved in monocytes migrating from blood to brain in AD patients PMID: 23967336
BCG-triggered increase of lipid body biogenesis was inhibited by the PPARgamma antagonist GW9662, but not by the NF-kappaB inhibitor JSH-23. In contrast, KC/CXCL1 production was largely dependent on NF-kappaB but not on PPARgamma PMID: 24120921
IL-17 and TNF-alpha synergistically mediate CXCL1 production by ATII cells after ischemia/reperfusion, via an NADPH oxidase-dependent mechanism. PMID: 24186876
excessive CXCL1 expression in gp130-deficient endothelial cells augments neutrophil adhesion but hinders migration, most likely by disrupting chemotactic gradients PMID: 24081661
KC, a potent neutrophil chemoattractant and an established angiogenic factor, failed to interfere in the post-infarction inflammatory response, in wound healing and scar formation after MI. PMID: 23598282
Molecular basis of glycosaminoglycan heparin binding to the chemokine CXCL1 dimer. PMID: 23864653
Overexpression and distinct localization of LCN2, CXCL1 and CXCL9 in the liver of fatty liver Shionogi mice suggest significant roles of these proteins in the pathogenesis of non-alcoholic steatohepatitis. PMID: 23875831
At day 10, CIP treatment not only significantly reduced pro-inflammatory cytokine and chemokine concentrations, including interleukin-6 (IL-6) and KC, but it also enhanced IL-3 production compared to vehicle-treated controls. PMID: 23520506
In severe S. aureus bacteraemia in mice, TNF-alpha, IL-1alpha, and KC are biomarkers predicting fatal outcome of infection. PMID: 23520553
the model that mast cells, optimally positioned in close proximity to the vasculature, initiate an early phase of neutrophil recruitment by releasing the chemoattractants CXCL1/CXCL2. PMID: 23645836
When expressed, CXCL1 is limited to small areas with faint staining and PCa progression does not rely on CXCL1 expression. PMID: 23334998
MMP9 expressed by intestinal epithelial cells mediates inflammation in colitis with simultaneous increase in proinflammatory cytokine Kc. PMID: 23471340
Early systemic release of IL-6 and keratinocyte-derived chemokine Cxcl1 may not necessarily predict an unfavorable outcome in this model of stroke. PMID: 22533966
Intrahepatic CXCL1 & circulating CXCL1 were strongly induced shortly after islet infusion. Blockade of the CXCL1-CXCR1/2 axis in mice improved intrahepatic islet engraftment. The CXCR1/2-mediated pathway is a regulator of islet damage. PMID: 22996693

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.