Recombinant Mouse Insulin-1 (INS1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02654P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Insulin-1 (INS1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02654P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Insulin-1 (INS1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P01325
Target Symbol INS1
Synonyms Ins1; Ins-1; Insulin-1 [Cleaved into: Insulin-1 B chain; Insulin-1 A chain]
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Expression Range 25-108aa
Protein Length Full Length of Mature Protein
Mol. Weight 14.5kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location Secreted.
Protein Families Insulin family
Database References

Gene Functions References

  1. Impairment in the insulin-Snail1 axis may contribute to non-alcoholic fatty liver disease in obesity. PMID: 30013137
  2. Feeding of high fat diet leads to impairment of brain insulin signaling linked with neuroinflammation. Insulin resistance due to high fat diet associated with biochemical changes in markers related with Alzheimer disease pathology. PMID: 27771511
  3. High INS1 expression is associated with weight gain and obesity. PMID: 29122848
  4. psychological stress impairs insulin signaling and results in hippocampal deficits. PMID: 29970188
  5. Our data shed light on the putative role of Kv1.3 in weight gain and insulin-dependent responses contributing to knowledge about adipocyte physiology. PMID: 29947924
  6. Data suggest that hybrid insulin peptides (HIPs), formed in insulin-secreting-cells by fusion of insulin C-peptide fragments to peptide fragments of chromogranin A or islet amyloid polypeptide, and reactivity of CD4+-T-lymphocytes to HIPs may act as biomarkers of autoimmunity in type 1 diabetes. PMID: 29976617
  7. Our findings, focusing on energy balance, provide a mechanistic understanding of the promising effect of early insulin initiation on lipotoxicity. Insulin, by recovering UCP3 activity, alleviated energy surfeit and potentiated AMPK-mediated lipid homeostasis in skeletal muscle cells following exposure to PA and in gastrocnemius of mice fed HFD. PMID: 29039450
  8. In the present study, the mRNA expression of the two mouse insulin genes Ins1 and Ins2 was investigated in MIN6 cells treated with different concentrations of melatonin, and insulin secretion was detected under the same conditions. Following the overexpression or silencing of MTNR1B, the activities of components of the MAPK signaling pathway PMID: 29207116
  9. diabetic gastroparesis was an aggressive process due to the successive damages of myenteric cholinergic neurones and ICC by impairing the insulin/InsR and IGF-1/IGF-1R signaling. Insulin therapy in the early stage may delay diabetic gastroparesis PMID: 28931726
  10. nNOS mediates insulin- and oxidative stress-induced glucose uptake in skeletal muscle myotubes. PMID: 28666850
  11. Data (including data from studies using knockout mice) suggest that Ins1 and Ins2 are required for pancreatic beta-cell maturation; thus, Ins1 and Ins2 are needed for normal beta-cell development and for maintenance of normal beta-cell function. PMID: 29029025
  12. Despite higher endogenous insulin concentrations following feeding, arcuate nucleus phosphorylation of Akt (pAkt) levels were significantly lower in the pregnant group compared with the nonpregnant group. PMID: 29029017
  13. Our current results reinforce the notion that the AT2R has a physiological role in the conservation of insulin action PMID: 27979738
  14. E4-ORF1 activation of PI3K in adipocytes recapitulates insulin regulation of FoxO1 but not regulation of Glut4. This uncoupling of PI3K effects occurs despite E4-ORF1 activating PI3K and downstream signaling to levels achieved by insulin PMID: 28009298
  15. These data support a role for islet NGF in fine-tuning insulin secretion. PMID: 27424144
  16. PDX1 and ISL1 regulation of insulin gene expression in pancreatic beta cells, was investigated. PMID: 26994512
  17. insulin and aPC converge on a common spliced-X-box binding protein-1 (sXBP1) signaling pathway to maintain endoplasmic reticulum (ER) homeostasis. PMID: 28687614
  18. Insulin stimulation of Akt1 and Akt2 signaling in Cystic fibrosis airway cells was diminished compared with that observed in airway cells expressing wild-type CFTR. PMID: 28213469
  19. These data implicate the insulin-FoxM1/PLK1/CENP-A pathway-regulated mitotic cell-cycle progression as an essential component in the beta cell adaptation to delay and/or prevent progression to diabetes. PMID: 28286049
  20. Rac1 activation is caused by membrane translocation of a guanine nucleotide exchange factor FLJ00068 in Akt2-mediated insulin signaling in mouse skeletal muscle. PMID: 27163697
  21. Netrin-1 enhanced insulin secretion by promoting beta-cell Ca(2+) influx and cAMP production. PMID: 27520508
  22. This study identifies AR as a novel receptor that enhances beta cell function. PMID: 27133133
  23. The effects were abolished by using pharmacological inhibition of PI3K/Akt with LY294002 and paralleled by transfecting DCs with klotho siRNA. In conclusion, the regulation of klotho sensitive DC function by IGF-1 or insulin is mediated through PI3K/Akt signaling pathway in BMDCs. PMID: 27808000
  24. Overexpression of either ca-Nfatc2 or ca-Nfatc1 in mouse islets enhanced insulin secretion, whereas only ca-Nfatc2 was able to promote b-cell proliferation, suggesting distinct molecular pathways mediating insulin secretion vs. b-cell proliferation are regulated by NFAT PMID: 27935966
  25. BMP-7 therefore is an attractive candidate for tackling a multifaceted disease such as diabetes, since it not only reduces body fat, but also strengthens insulin signaling, causing improved glucose uptake and ameliorating peripheral insulin resistance. PMID: 28186649
  26. these findings demonstrate, for the first time, that miR-155 is a positive regulator of insulin sensitivity with potential applications for diabetes treatment. PMID: 27711113
  27. Maternal chromium restriction leads to glucose metabolism imbalance in mice offspring through insulin signaling and Wnt signaling pathways. PMID: 27782077
  28. Hyperglycemia and hyperlipidemia blunts the Insulin-Inpp5f negative feedback loop in the diabetic heart. PMID: 26908121
  29. Data suggest that resveratrol acts on differentiating preadipocytes by inhibiting insulin signaling, mitochondrial biogenesis, and lipogenesis. PMID: 26968895
  30. elevating nuclear O-GlcNAc increases intracellular insulin levels and preserves glucose-stimulated insulin secretion during chronic hyperglycemia PMID: 26598517
  31. Data (including data from studies in knockout/transgenic mice) suggest INS is required for lipogenic effects of activation of LXRalpha in liver; INS is not required to down-regulate gene expression in ER stress or inflammation (as seen in diabetes). PMID: 26511317
  32. the insulin-InsR signaling drives multipotent progenitors differentiation into lymphoid lineages in early lymphopoiesis. PMID: 26573296
  33. The target miRNAs are closely associated with dysregulation of insulin/PI3K-AKT signaling, suggesting that the Cmah-null mice could be a useful model for studying diabetes. PMID: 25243123
  34. the inhibitory effect of CRFR2 signaling on insulin action is mediated by cAMP in a mammalian target of rapamycin-dependent manner. PMID: 25875045
  35. This study discloses age-dependent changes in insulin CSF/serum ratios in humans. In the elderly, cerebral insulin resistance might be partially attributed to an impaired transport of insulin into the central nervous system PMID: 25965336
  36. adiponectin. Taken together, our results show that adiponectin is stored in a unique vesicular compartment, and released through a regulated exocytosis pathway that is dependent on insulin signalling. PMID: 26330614
  37. LKB1 is essential for mitochondrial maintenance and negatively regulates a distal step of insulin secretion. PMID: 26139601
  38. ubiquitin-like protein 4A (Ubl4A) plays a crucial role in insulin-induced Akt plasma membrane translocation. PMID: 26195787
  39. synaptotagmin-7 is directly activated by GLP-1 signaling and may serve as a drug target for boosting insulin secretion. PMID: 26216970
  40. The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose. PMID: 26076035
  41. Tcf7l2 is regulating proinsulin expression directly via Isl1, Ins1 and indirectly via MafA, NeuroD1 and Pdx1. PMID: 25015099
  42. elevated adiponectin levels improve systemic lipid metabolism in the near absence of insulin. PMID: 25339419
  43. the RhoA/ROCK signaling pathway is involved in insulin release through the up-regulation of Cx36 expression in 3D-cultured MIN6 cells. PMID: 25129107
  44. Analyzed was insulin translation in islets and in INS-1 cells. Insulin translational levels were significantly increased in islets of mice fed a high-fat diet to meet systemic demand, without altering its transcriptional levels. PMID: 25686499
  45. Data indicate that Src homology-2 domain containing protein B (SHB) deficiency causes a chronic increase in beta-cell focal adhesion kinase (FAK) activity that perturbs the normal insulin secretory characteristics of beta-cells. PMID: 25274988
  46. The activation of Cav-1 during the adipocyte differentiation process could facilitate the maintenance of insulin sensitivity by mature adipocytes isolated from additional external stimuli. PMID: 24751908
  47. GX sPLA2 negatively regulated pancreatic insulin secretion by augmenting COX-2-dependent PGE2 production. PMID: 25122761
  48. Diet-induced obesity mice exhibited significant increases in body weight, plasma glucose, insulin, and IGF1. PMID: 24914941
  49. The over-expression of miR-200a in the hypothalamus of obese mice is linked to leptin and insulin signaling impairment. PMID: 24394757
  50. Mouse Ins2 and Ins1 promoters were transiently activated in mouse fetal hepatocytes of embryonic days 13.5 and 16.5, respectively. PMID: 24258027

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed