Recombinant Mouse Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc)

Name: Recombinant Mouse Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-00244P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q61581
Target Symbol	IGFBP7
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
Expression Range	26-281aa
Protein Length	Full Length
Mol. Weight	55.3 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds IGF-I and IGF-II with a relatively low affinity Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Subcellular Location	Secreted.
Database References	KEGG: mmu:29817 UniGene: Mm.233470
Tissue Specificity	Expressed at high levels in lung, kidney, small intestine, testis and uterus and at moderate levels in liver.

Gene Functions References

Our findings define an immune component of the pleiotropic mechanisms through which IGFBP7 suppresses hepatocellular carcinoma PMID: 28619711
Study shows that IGFBP7 contributes significantly to mesenchymal stromal cells (MSC)-mediated immune modulation, as is shown by decreasing ability of IGFBP7 knockdown in MSCs to restore proliferation and cytokine production in T-cells. PMID: 27397633
data suggest that IGFBP-7 was up regulated during EAE and inhibit the transition from OPCs to mature OLs, implying its use as a potential therapeutic target for the treatment of inflammatory demyelinating diseases PMID: 25819415
Our data suggest that loss of Igfbp7 induces precocious involution possibly through diminished cell survival signals. PMID: 24505323
Angiomodulin is necessary for cardiac commitment of embryonic stem cells (ESCs) and its regulation depends on TAp63 isoform. PMID: 24145187
a model whereby IGFBP7 binds to unoccupied IGF1R and suppresses downstream signaling, thereby inhibiting protein synthesis, cell growth, and survival. PMID: 23250396
IGFBP7 has a novel role in mouse uterus: it is regulating uterine receptivity through Th1/Th2 lymphocyte balance and decidualization. PMID: 23028860
fear extinction-induced IGF2/IGFBP7 signalling promotes the survival of 17-19-day-old newborn hippocampal neurons PMID: 21873981
Results demonstrate that the vascular-specific marker angiomodulin (AGM) modulates vascular remodeling in part by temporizing the proangiogenic effects of VEGF-A. PMID: 19542015
study showed that IGFBP-rP1 (IGFBP7) was expressed in dysregulated podocytes in a human immunodeficiency virus-associated nephropathy model and in immature podocytes in the developing kidney; conclude that IGFBP-rP1 may be a product of injured podocytes PMID: 20630940
Mac25 interacts with the extracellular matrix proteins and glycosaminoglycans that are expressed in most blood vessels including high endothelial venules, as well as with chemokines implicated in regulation of lymphocyte trafficking, e.g., SLC and IP-10. PMID: 12847218
Proteolytic processing of mac25 modulates its insulin/IGF-1-dependent growth-stimulatory activity. PMID: 14521955
IGFBP-7 can regulate glioma cell migration through the AKT-ERK pathway, thereby playing an important role in glioma growth and migration PMID: 19048112

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.