Recombinant Mouse Insulin-Like Growth Factor Ii (IGF2) Protein (His)

Name: Recombinant Mouse Insulin-Like Growth Factor Ii (IGF2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04908P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Insulin-Like Growth Factor Ii (IGF2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P09535
Target Symbol	IGF2
Synonyms	Igf2; Igf-2Insulin-like growth factor II; IGF-II; Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Expression Range	25-91aa
Protein Length	Full Length of Mature Protein
Mol. Weight	13.4 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable). IGF2 is influenced by placental lactogen (Probable). Also involved in tissue differentiation (Probable). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
Subcellular Location	Secreted.
Protein Families	Insulin family
Database References	KEGG: mmu:16002 STRING: 10090.ENSMUSP00000114076 UniGene: Mm.3862
Tissue Specificity	Expressed in the heart, blood serum, kidney and skeletal muscle including the tibialis anterior muscle.

Gene Functions References

Myogenesis-associated long noncoding rna promotes myogenesis by functioning as a competing endogenous RNA for microRNA-125b to control protein abundance of IGF2. PMID: 28281528
DIS3L2 loss of function results in transcriptional activation of the Igf2/H19 locus in nephron progenitor cells, most likely by leading to the activation of shared cis-regulatory elements that control these genes. PMID: 29950491
the effect of ZBED6 on growth of muscle and internal organs is mediated through the binding site in the Igf2 gene PMID: 29440408
Rapamycin-independent IGF2 expression in Tsc2-null mouse embryo fibroblasts and human lymphangioleiomyomatosis cells. PMID: 29758070
IGF2 is silenced in mouse embryos by the zinc finger protein ZFP568 PMID: 28522536
These findings indicate that IGF-II reduces PGC-1alpha expression in skeletal muscle cells through a mechanism involving PI3K-Akt-FoxO1 but not p38 MAPK or Erk1/2 MAPK pathways. PMID: 28374141
produced by pericentral hepatocytes to promote hepatocyte proliferation and repair tissue damage in the setting of chronic liver injury PMID: 28653763
Here the authors show that fibroblast growth factor 22 (FGF22), a derived presynaptic organizer in the mouse hippocampus, induces the expression of insulin-like growth factor 2 (IGF2) for the stabilization of presynaptic terminals. PMID: 27083047
Loss of Igf2 Gene Imprinting is associated with Prostate Cancer. PMID: 28775169
IGF2 controls bone growth by regulating glucose metabolism in chondrocytes. PMID: 28974642
These results demonstrate that overexpressed IGF-2 is the major tumorigenic driver in a subset of CRCs and encourage testing of MEDI-573, alone and in combinations, in IGF2-overexpressing CRC patients. PMID: 27399333
Our study reveals that the expression level of Igf2 is critical to maintain the balance between stem cell self-renewal and differentiation, presumably by regulating the interaction between HSC and their niche. PMID: 28007480
analysis of the distal muscle enhancer in the mouse Igf2 locus PMID: 26645089
Data indicate that the effects of insulin-like growth factor 2 (IGF2) are mediated by direct upregulation of the cyclin-dependent kinase inhibitor p57 (p57). PMID: 26872540
Mstn may negatively regulate Igf2 expression to control postnatal skeletal muscle growth, however differences in growth between male and female mice are not readily explained by changes in expression of Igf family members. PMID: 26198127
Study provides evidence for regulation of Igf2 by microRNAs and further elucidates the role of miR141-3p and miR-200a-3p in the mouse placental development. PMID: 26247408
IGF2 contributes to neural stem cell maintenance in subventricular zone but not in the subgranular zone, and this is regulated by the biallelic expression of IGF2 in the vascular compartment. PMID: 26369386
results uncovered a distinctive pro-IGF-II-mediated self-reinforcement mechanism of muscle regeneration PMID: 25917344
Data (including data from studies in knockout mice) suggest that, in aging and metabolic stress such as insulin resistance/pregnancy, pancreatic beta-cells exhibit sex differences in expression of Igf2 during beta-cell expansion/mass adaptation. PMID: 26384384
case of Balb/3T3 the concentration of IGF2 in culture supernatants decreased after 1 and 5 mM and increased after 10 mM of metformin. metformin influences the cytophysiology of somatic cells causing inhibition of proliferation PMID: 26064951
ZBED6 inhibits IGF2 activity. PMID: 24691566
Insulator activity of the H19/Igf2 imprinting control region varies by cell type and may depend on cell-specific enhancers as well as posttranslational modifications of the insulator protein CTCF. PMID: 24990148
upregulation of IGF2/Igf2 is likely controlled by hypermethylation of H19 DMR1 in human NTDs, however, in acute external RA-induced NTD mice it is potentially determined by more open chromatin structure PMID: 25423083
Data indicate that hedgehog (Hh) signaling activated the expression of insulin-like growth factor 2 (Igf2) that during osteoblast differentiation. PMID: 25825734
Data show that adeno-associated virus AAV8-mediated expression of insulin-like growth factor 2 (IGF2) reverses both memory and dendritic spine density impairments. PMID: 25100745
These results potentially indicate that IGF2 may mediate vascular smooth muscle cells calcification via the stimulation of Erk1/2 and Akt signalling. PMID: 24482492
Insulin-like growth factor-2 enhances functions of antigen (Ag)-specific regulatory B cells. PMID: 24811165
it was PDGF, NT-3 and IGF-2 in combination that conducted the transdifferentiation PMID: 24454677
The down-regulation of Igf2 and Peg3 imprinted genes in adipocytes may be involved in the paternal transmission of high-fat diet-induced obesity. PMID: 24416415
IGF-2 expression is elevated in enterocytes and is required for the hyperplastic intestinal mucosal phenotype of retinoblastoma protein (Rb) knockout mice. Findings reveal novel regulatory roles for Rb in expanding intestinal mucosal surface area. PMID: 23845628
Mice engineered to be null for the placenta-specific P0 transcript (insulin-like growth factor-2-P0 knockout) reveal a role for the placenta in long-term programming of emotional behaviour. PMID: 23921428
The aim of this study was to characterize the ocular morphology of low-density lipoprotein receptor-deficient apolipoprotein B-100-only mice, with IGF-II overexpression. PMID: 23922490
show that expression of IGF2R protein was reduced to less than 50% overall in tissues previously known to be Igf2 growth dependent. This occurred despite the detection of mouse derived peptides PMID: 23468951
This work reveals the fundamental importance of IGF-II in the mature podocyte for glomerular health across mammalian species. PMID: 23299523
Beta cell regeneration in adult mice depends on re-expression of IGF-II. PMID: 22970135
mTOR regulates organismal growth by promoting IGF2 production in the mouse embryo through mTORC2-catalyzed cotranslational IMP1/IMP3 phosphorylation PMID: 23388827
a link between the mechanisms for maintenance of the unmethylated state of the H19/Igf2 ICR and the undifferentiated cell-specific induction of DNA demethylation. PMID: 23115243
IGF-II isoforms possess unique biological properties that may enable them to escape normal sequestration avenues and remain bioavailable in vivo to sustain oncogenic signaling PMID: 23166326
The growth factor IGF2 is a mild contributor to malignant adrenocortical tumourigenesis. PMID: 22952916
These results provide the first in vivo evidence that a myogenic regulator together with a growth factor act simultaneously but through independent pathways to repress Prdm16, which opens potential therapeutic perspectives for human metabolic disorders. PMID: 22859371
a persistent infection of a thymic epithelial cell line with enteroviruses like CV-B4 E2 can result in a disturbed production of IGF-2, a protein involved in central self-tolerance toward islet beta cells. PMID: 22855493
The Igf2 decreased specifically in the central nucleus of the amygdala after chronic immobilization stress. PMID: 22672618
The authors observed Igf2 genetic dependency of the p53 null phenotype during embryonic development and tumour formation. PMID: 22674894
These data indicate that the effects of Pten loss at heterozygote levels commonly observed in human tumours are modified by Igf2 ligand, and emphasise the importance of the evaluation of upstream pathways in tumours with Pten loss. PMID: 22120709
Data show that both Akt1-/- and Igf2-/- mice exhibited decreased placental weight, fetal weight and viability. PMID: 22562201
IGF-IR-mediated activation of intracellular signaling may play a critical role during oxidative stress-induced apoptosis in necrotizing enterocolitis. PMID: 22434232
This study illustrated a fundamental role of IKK/NF-kappaB-Igf2-Igf2R signaling in synapse formation and maturation in adult mice. PMID: 22514330
System A activity and vascular function in the placental-specific Igf2 knockout mouse. PMID: 21851977
fear extinction-induced IGF2/IGFBP7 signalling promotes the survival of 17-19-day-old newborn hippocampal neurons PMID: 21873981
observed that deletion of placental-specific transcript of IGF-II prevented up-regulation of amino acid transfer normally seen in undernourished wild-type placenta PMID: 21673101

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.