Recombinant Mouse Interferon alpha/beta receptor 1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0761P
Recombinant Mouse Interferon alpha/beta receptor 1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0761P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P33896 |
Synonym | Alpha type antiviral protein Antiviral protein, alpha-type Antiviral protein, beta-type AVP Beta type antiviral protein CRF2-1 Cytokine receptor class-II member 1 Cytokine receptor family 2 member 1 IFN alpha REC IFN alpha receptor IFN alpha/beta Receptor alpha IFN beta receptor IFN Interferon-beta receptor IFN-alpha/beta receptor 1 IFN-R-1 IFNAR Ifnar1 IFNBR IFRC INAR1_HUMAN Interferon (alpha beta and omega) receptor 1 interferon alpha and beta receptor subunit 1 Interferon alpha/beta receptor 1 Interferon alpha/beta receptor alpha chain Interferon beta receptor 1 interferon receptor 1 Interferon-alpha receptor Type I interferon receptor 1 |
Description | Recombinant Mouse Interferon alpha/beta receptor 1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | ENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEAKWLKVP ECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYTA HMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSD KKTINSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVA NKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSD KWKPIPTCANVQTTHCVFSQDTVYTGTFFLHVQASEGNHTSFWSEEKFID SQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDGLNYEIIFWENTSNTKI SMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCEKTRPGS FSTLEHHHHHH |
Molecular Weight | 47 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |