Recombinant Mouse Interferon Alpha/Beta Receptor 2 (IFNAR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04628P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Interferon Alpha/Beta Receptor 2 (IFNAR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04628P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Interferon Alpha/Beta Receptor 2 (IFNAR2) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O35664 |
Target Symbol | IFNAR2 |
Synonyms | Ifnar2; Interferon alpha/beta receptor 2; IFN-R-2; IFN-alpha/beta receptor 2; Type I interferon receptor 2 |
Species | Mus musculus (Mouse) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA |
Expression Range | 22-242aa |
Protein Length | Extracellular Domain |
Mol. Weight | 26.8 kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted. |
Protein Families | Type II cytokine receptor family |
Database References | |
Tissue Specificity | Widely expressed. Detected in liver, testis, kidney, salivary gland, thymus, brain, lung and placenta. Isoform 1, isoform 2 and isoform 3 are expressed in brain. |
Gene Functions References
- We found that STAT-1(-/-) MRL lpr m, but not IRF-9(-/-) or IFNAR-2(-/-) mice, developed interstitial nephritis characterized by infiltration with RORgammat-positive lymphocytes, macrophages, and eosinophils. PMID: 26636548
- mTORC2 has a central role in IFNgamma signaling and type II IFN responses PMID: 26645692
- In this study, we elucidate the in vivo importance of the soluble type I IFNAR, soluble (s)IFNAR2a PMID: 24696235
- In this study we have characterized the Stat2-IFNaR2 interaction and examined its role in IFNalpha signaling PMID: 11786546
- regions in promoter that confer basal and inducible expression PMID: 11939908
- studies reveal that a single conserved IFNAR2 tyrosine, Y(510), plays a critical role in directing the IFN-I-dependent activation of STAT1 and STAT2, both in murine fibroblasts and macrophages PMID: 18390731
- Our studies provide a critical link between the IFN-I pathway and the regulation of TLR-specific B-cell responses in a murine model of Systemic lupus erythematosus PMID: 19624844
- ability of L. pneumophila to induce IFN-I expression was found to be dependent on IRF-3, but not NF-kappaB. Secreted IFN-Is then in turn suppress the intracellular replication of L. pneumophila PMID: 19720834