Recombinant Mouse Interleukin-1 Beta (IL1B), Active

Beta LifeScience SKU/CAT #: BLC-05317P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Mouse Interleukin-1 Beta (IL1B), Active

Beta LifeScience SKU/CAT #: BLC-05317P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Interleukin-1 Beta (IL1B), Active is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
Uniprotkb P10749
Target Symbol IL1B
Synonyms Il1bInterleukin-1 beta; IL-1 beta
Species Mus musculus (Mouse)
Expression System E.coli
Tag Tag-Free
Complete Sequence VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Expression Range 118-269aa
Protein Length Full Length of Mature Protein
Mol. Weight 17.4 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6.
Subcellular Location Cytoplasm, cytosol. Lysosome. Secreted, extracellular exosome. Cytoplasmic vesicle, autophagosome. Secreted.
Protein Families IL-1 family
Database References
Tissue Specificity Expressed in activated macrophages (at protein level).

Gene Functions References

  1. propofol was the most potent inhibitor of IL-1beta secretion and ROS level in S. aureus-infected RAW264.7 cells; moreover, propofol resulted in an increase in bacterial survival by inhibiting ROS and phagocytosis. PMID: 29667111
  2. P7 is an intracellular proton-gated H +-channel of the hepatitis C virus . P7 activity induced production of interleukin IL-1beta in liver macrophages. PMID: 27979709
  3. These results indicate that in RGCs, ANXA1 increases IL-1beta expression by recruiting p65 to the nucleus, which induces cell apoptosis. The obtained results may help the development of a novel treatment strategy against RGCs apoptosis in acute ischemia-reperfusion injury. PMID: 28389361
  4. Macrophage-derived IL1B/NF-kappaB signaling mediates parenteral nutrition-associated cholestasis in a mouse model. PMID: 29643332
  5. fenretinide impaired proinflammatory cytokine interleukin 1 beta (IL-1beta) production in response to A. fumigatus exposure with contributions by lectin-type oxidized LDL receptor 1 (LOX-1) and c-Jun N-terminal kinase (JNK). PMID: 30211745
  6. observation from the present research work reveals that Quercetin suppressed the production of proinflammatory cytokines at different levels, such as TNF-alpha and IL-1beta, and inhibits the activation of I-kappaB phosphorylation, whereas the total content was not affected. PMID: 29322353
  7. Overall, the authors showed that CCN1 increased IL-1beta production via p38 MAPK signaling, indicating a role for CCN1 protein in regulating inflammation in psoriasis. PMID: 28266627
  8. In fibrocystin/polyductin complex-defective cholangiocytes, beta-catenin and IL-1beta are responsible for signal transducer and activator of transcription 3-dependent secretion of CXCL10 PMID: 29140564
  9. These results suggest that mitochondrial ROS-TXNIP/NLRP3/IL-1beta axis activation is responsible for tubular oxidative injury, which can be ameliorated by MitoQ via the inhibition of mtROS overproduction PMID: 29475133
  10. Circadian clock protein BMAL1 regulates IL-1beta in macrophages via NRF2. PMID: 30127006
  11. TLR2 and NLRP3 inflammasome activation in cardiac macrophages mediate the production of IL-1beta in diabetic mice. IL-1beta causes prolongation of the action potential duration, induces a decrease in potassium current and an increase in calcium sparks in cardiomyocytes, which are changes that underlie arrhythmia propensity. PMID: 27882934
  12. show that mutant KRAS facilitates IKKalpha-mediated responsiveness of tumor cells to host IL-1beta, thereby establishing a host-to-tumor signaling circuit that culminates in inflammatory MPE development and drug resistance PMID: 29445180
  13. identify interleukin-1 beta as an upstream trigger for the upregulation of interactions between USP5 and Cav3.2 channels in the pain pathway PMID: 28741432
  14. The present study demonstrated that IL-1b may induce ICAM-1 expression, thus enhancing the cohesion between mesenchymal stem cells and endothelial progenitor cells via the p38 MAPK signaling pathway. PMID: 29393395
  15. SAG2A differentially modulates IL-1beta expression in resistant and susceptible murine peritoneal macrophages cells. PMID: 29353306
  16. High IL-1beta expression is associated with experimental autoimmune encephalomyelitis. PMID: 29358392
  17. tibias of botulin A toxin-treated and tail-suspended mice, which featured unloading and decreased bone mass, showed higher expression of IL-1beta, Lcn2 and Nos2, suggesting their pathophysiologic involvement in endothelial cell-osteoblast crosstalk. PMID: 27430980
  18. HMGB1/IL-1beta complexes released after burn injuries can modulate immune responses PMID: 29601597
  19. bone marrow-derived macrophages (BMM) and three murine macrophage cell lines, J774.1, J774A.1, and RAW264.7 were exposed to ATP or fibrous titanium dioxide (FTiO2) in the presence or absence of lipopolysaccharide (LPS), and the concentrations of IL-1beta and IL-6 in both cell lysates and in the culture media were measured by immunoblotting to differentiate active form of IL-1beta from pro-IL-1beta. PMID: 28766178
  20. The present study demonstrates a novel mechanism underlying LPS-induced innate immunity; that is, a secondary upregulation of IL-1beta-IL-1RI signaling is responsible for alveolar macrophages pyroptosis and augmented lung injury in response to LPS. PMID: 27526865
  21. IL-33 may induce Th17 cell responses via IL-1beta and IL-6 derived from IL-33-matured dendritic cells. PMID: 28802996
  22. ESP of fifth-stage larval Angiostrongylus cantonensis stimulates astrocyte activation and IL-1beta and IL-6 production through NF-kappaB and the Shh signaling pathway. PMID: 28950910
  23. we confirmed that Th1 cell-conditioned medium decreased Cx43 protein levels in mixed glial cell cultures. These findings suggest that Th1 cell-derived IFNg activates microglia to release IL-1b that reduces Cx43 gap junctions in astrocytes. Thus, Th1-dominant inflammatory states disrupt astrocytic intercellular communication and may exacerbate multiple sclerosis. PMID: 27929069
  24. This finding shows that autophagy and NLRP3 inflammasome activation are connected, and that PTPN22 plays a key role in the regulation of those 2 pathways. PMID: 28786745
  25. These data suggest that amyloid formation leads to reduced PKB phosphorylation in beta-cells which is associated with elevated islet IL-1beta levels. Inhibitors of amyloid or amyloid-induced IL-1beta production may provide a new approach to restore phospho-PKB levels thereby enhance beta-cell survival and proliferation in conditions associated with islet amyloid formation PMID: 29474443
  26. Mice treated with HW for 4 weeks demonstrated a significant decrease in the AD severity score compared with PW-treated mice (p less than 0.01). Hydrogen water administration also significantly reduced TEWL and serum TARC levels (p less than 0.01), infiltration of mast cells (p less than 0.05), and secretion of the proinflammatory cytokines interleukin (IL)-1beta and IL-33 (p less than 0.05) in skin lesions compared wit... PMID: 28889151
  27. Curcumin attenuated neuropathic pain and down-regulated the production of spinal mature IL-1beta by inhibiting the aggregation of NALP1 inflammasome and the activation of the JAK2-STAT3 cascade in astrocytes. PMID: 27381056
  28. results altogether demonstrate distinct roles of SHARPIN in initiating systemic inflammation and dermatitis. Furthermore, skin inflammation in Sharpin(cpdm) mice is specifically modulated by IL-1beta, highlighting the importance of specific targeted therapies in the IL-1 signaling blockade. PMID: 27892465
  29. Food-grade synthetic amorphous silica particles are able to directly initiate the endosomal MyD88-dependent pathogen pattern recognition and signaling pathway in steady-state dendritic cells. The ensuing activation of immature DCs results in de novo induction of pro-IL-1beta. PMID: 28645296
  30. the present study confirmed that miR98 targeted the 3'untranslated region of Bcl2. In conclusion, miRNAcoordinated regulation of apoptosisassociated protein expression has been identified in Osteoarthritis chondrocytes following IL1beta induction. PMID: 28765925
  31. Results provide evidence that IL-1beta does not contribute to the pathophysiology of doxorubicin-induced cardiotoxicity. PMID: 27225830
  32. Alendronate (ALN)-augmented IL-1beta production and cell death require Smad3 and ASC activation, and SIS3 and anti-ASC antibodies may serve as palliative agents for necrotizing inflammatory diseases caused by ALN PMID: 29438662
  33. urinary LRG is produced in renal tubular epithelial cells by interleukin-1beta (IL-1beta) that is released during proteinuria-induced renal damage PMID: 29550485
  34. These data reveal how, upon XIAP deficiency, a TLR-TNF-TNFR2 axis drives cIAP1-TRAF2 degradation to allow TLR or TNFR1 activation of RIPK3-caspase-8 and IL-1beta. This mechanism may explain why XIAP-deficient patients can exhibit symptoms reminiscent of patients with activating inflammasome mutations. PMID: 28723569
  35. IL-1beta exerts variable effects on long-term potentiation at different kinds of synapses, indicating that IL-1beta has synapse-specific effects on hippocampal synaptic plasticity. PMID: 28637953
  36. we assessed the role of RIP3 in synergy with Caspase-1 in the induction of IL-1beta production in BMDM after either LPS/ATP or Chlamydia muridarum stimulation. The possibility of pyroptosis and necroptosis interplays and the role of RIP3 in IL-1beta production during Chlamydia muridarum infection in BMDM was investigated as well. PMID: 28660207
  37. Inhibition of signaling stimulated by both TNF and IL1beta synergizes with NF-kappaB inhibition in eliminating leukemic stem cells. PMID: 28039479
  38. Parenchymal polymorphonuclear myeloid-derived suppressor cell (PMN-MDSC), have a positive correlation with IL1a, IL8, CXCL5, and Mip-1a, suggesting they may attract PMN-MDSC into the tumor PMID: 27799249
  39. Chemokine receptor 2 (CCR2(+)) monocytes invade the hippocampus between 1 and 3 d after SE. In contrast, only an occasional CD3(+) T lymphocyte was encountered 3 d after SE. The initial cellular sources of the chemokine CCL2, a ligand for CCR2, included perivascular macrophages and microglia. The induction of the proinflammatory cytokine IL-1beta was greater in FACS-isolated microglia than in brain-invading monocytes PMID: 27601660
  40. hypernociception in experimental model of autoimmune encephalomyelitis may be a consequence of the increase in some cytokines in dorsal root ganglia, especially IL-1beta. PMID: 26614512
  41. An OA model was established in mouse articular chondrocytes (MACs) treated by interleukin-1beta (IL-1beta). PMID: 29247798
  42. The current study demonstrated that honey can stimulate or suppress the mRNA expression of some pro-inflammatory cytokines in mice brains. Furthermore, honey suppresses the TNF-alpha mRNA expression in the presence of T. gondii infection but it stimulates the IL-1beta and IL-6 mRNA expression. Treatment of the mice with honey reduces parasite multiplication in the brain. PMID: 27591508
  43. IL-1beta has a direct effect on NGAL production by tubular epithelial cells. PMID: 27997859
  44. Elevations of CO2 cause oligomerization of the inflammasome components ASC, NLRP3, caspase 1, thioredoxin interacting protein, and calreticulin - a protein from endoplasmic reticulum, leading to IL-1beta synthesis. An increased production rate of MPs containing elevated amounts of IL-1beta persists for hours after short-term exposures to elevated CO2 PMID: 28288918
  45. dimerized or endogenous caspase-8 can also directly cleave IL-1beta into its biologically active form, in the absence of canonical inflammasome components. PMID: 27419363
  46. In this newborn mouse lung hypoxia-reoxygenation model, we found downregulation of genes of mediators of inflammation, an antiapoptotic gene expression pattern, and downregulation of DNA glycosylases. Sod1 and Il1b were significantly differentially expressed when comparing reoxygenation using 60% O2 with air. PMID: 27529351
  47. Report direct role of pleural cells in the pathogenesis of bleomycin-induced pulmonary fibrosis via caspase-1/IL-1beta pathway. PMID: 27894300
  48. the senescence associated secretory phenotype was also increased significantly in the kidney of Sod1(-/)(-) mice compared to WT mice as measured by the expression of transcripts for IL-6 and IL-1b PMID: 27846439
  49. These studies elucidate an important role for neutrophils and IL-1beta in lung carcinogenesis. PMID: 27320908
  50. PLCd1 negatively regulates lipopolysaccharide-induced production of IL-1b and Fc gamma receptor-mediated phagocytosis in macrophages. PMID: 26643908

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Cytokines
Recently viewed