Recombinant Mouse LIF Protein
Beta LifeScience
SKU/CAT #: BLA-0788P
Recombinant Mouse LIF Protein
Beta LifeScience
SKU/CAT #: BLA-0788P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P09056 |
Synonym | CDF Cholinergic Differentiation Factor D factor DIA Differentiation inducing factor differentiation inhibitory activity Differentiation stimulating factor Differentiation-stimulating factor Emfilermin Hepatocyte stimulating factor III HILDA Human interleukin in DA cells Leukemia inhibitory factor LIF LIF_HUMAN Melanoma derived LPL inhibitor Melanoma-derived LPL inhibitor MLPLI |
Description | Recombinant Mouse LIF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQG EPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITR DQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
Molecular Weight | 20 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |