Recombinant Mouse LIF Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0792P
Recombinant Mouse LIF Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0792P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P09056 |
Synonym | CDF Cholinergic Differentiation Factor D factor DIA Differentiation inducing factor differentiation inhibitory activity Differentiation stimulating factor Differentiation-stimulating factor Emfilermin Hepatocyte stimulating factor III HILDA Human interleukin in DA cells Leukemia inhibitory factor LIF LIF_HUMAN Melanoma derived LPL inhibitor Melanoma-derived LPL inhibitor MLPLI |
Description | Recombinant Mouse LIF Protein (His tag) was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGE PFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRD QKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDH SDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
Molecular Weight | 21 kDa including tags |
Purity | >92% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |