Recombinant Mouse Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)

Name: Recombinant Mouse Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08390P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Colony-stimulating factors and receptors (csfs), Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P07141
Target Symbol	CSF1
Synonyms	Csf1; CsfmMacrophage colony-stimulating factor 1; CSF-1; MCSF) [Cleaved into: Processed macrophage colony-stimulating factor 1]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Expression Range	33-262
Protein Length	Partial
Mol. Weight	30.0kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.; [Processed macrophage colony-stimulating factor 1]: Secreted, extracellular space.
Database References	KEGG: mmu:12977 STRING: 10090.ENSMUSP00000014743 UniGene: Mm.795
Associated Diseases	A defect in Csf1 is the cause of osteopetrosis. Osteopetrotic mice (op/op) are severely deficient in mature macrophages and osteoclasts, display failed tooth eruption, and have a restricted capacity for bone remodeling.

Gene Functions References

In glioblastoma, colony-stimulating factor-1 and angiocrine IL-6 induce robust arginase-1 expression and macrophage alternative activation, mediated through peroxisome proliferator-activated receptor-gamma-dependent transcriptional activation of hypoxia-inducible factor-2alpha. PMID: 29422647
M-CSF serves as an intermediate signal, thus inducing a vital decrease in the NPR2 levels in cumulus cells, and regulates the process of LH-induced resumption of meiosis. PMID: 28978329
Findings revealed that stress-induced elevations in neuronal CSF1 provokes microglia-mediated neuronal remodeling in layer 1 medial prefrontal cortex, contributing to synaptic deficits and development of anxiety- and depressive-like behavior. Moreover, chronic stress exposure elicited divergent neuroimmune responses in male and female mice, demonstrating sex-dependent differences in neuron-microglia interactions. PMID: 28697890
PLEKHO2-deficient bone marrow-derived macrophages displayed increased apoptotic cell death in the absence of Macrophage-colony stimulating factor, although PLEKHO2 deficiency did not affect macrophage differentiation and proliferation. PMID: 28627369
lymphatic endothelial cells cause bone destruction in vivo in mice by secreting M-CSF, which promotes osteoclasts formation and activation. PMID: 28052488
address which CSF-1-activated pathways are involved in transmitting the lineage-instructive signal in primary bone marrow-derived GM progenitors. PMID: 28159742
study concludes that M-CSF is critical to host defenses against bacterial pneumonia by mediating survival and antimicrobial functions of mononuclear phagocytes in the lungs and liver. PMID: 27183631
study, therefore, provided insights into the sequence-structure-function relationships of the M-CSF/c-FMS interaction and of ligand/receptor tyrosine kinase interactions in general. PMID: 28655719
Therefore, our findings indicate that CSF1 signaling is oncogenic during gliomagenesis through a mechanism distinct from modulating glioma-associated microglia/macrophage polarization status PMID: 27013192
study concludes that Langerhans cells require IL-34 when residing in fully differentiated and anatomically intact skin epidermis, but rely on neutrophil-derived CSF1 during inflamma PMID: 26634935
Proteomic Analysis Reveals Distinct Metabolic Differences Between Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) and Macrophage Colony Stimulating Factor (M-CSF) Grown Macrophages Derived from Murine Bone Marrow Cells PMID: 26229149
Hematopoietic cells can be induced by M-CSF to dedifferentiate to multipotent stem cells. PMID: 26529564
M-CSF promotes macrophagic over granulocytic differentiation by inducing ERK activation but also PKCd expression, which in turn, down-regulates Fli-1 expression and prevents granulocytic differentiation. PMID: 26336156
Results identify CSF-1-activated macrophages as crucial mediators of detrimental Schwann cell dedifferentiation in Cx32-deficient mice PMID: 25628221
Ceramide production in M-CSF-deprived macrophages arises from a combination of ASMase activity and de novo synthesis. PMID: 26253821
CSF-1 did not rescue the growth and lung defects associated with hyperoxia in this model; however, an increase in CSF-1R+ macrophages was not associated with an exacerbation of lung injury. PMID: 25192716
CSF-1 neutralization led to a relatively uniform reduction in all inflammatory cell populations; GM-CSF neutralization resulted in the preferential loss among the monocyte/macrophage populations. PMID: 26019271
The results of this study indicated that the CSF1 overexpression observed in CNS pathologies likely has pleiotropic influences on microglia. PMID: 25042473
FoxO1 is highly expressed in M-CSF-derived (M2-like) macrophage subsets, and this M2-like macrophages showed a preferential FoxO1 enrichment on the IL-10 promoter but not in GM-CSF-derived (M1-like) macrophages PMID: 25420919
CSF-1 has a role in macrophage mediation of chronic graft-versus-host disease PMID: 25157821
tumor cells TACE-shed MCSF promotes angiogenesis through activation of the NF-kappaB pathway in macrophages and the subsequent release of VEGF. PMID: 24197832
these findings reveal a role for CSF-1 in mediating the IL-3 hematopoietic pathway through monopoiesis, which regulates expansion of CD11c+ macrophages. PMID: 24743235
Tbx3 plays an important role in osteoclastogenesis at least in part by regulating CSF1-dependent expression of JDP2. PMID: 24394418
in lung cancer bone metastasis, regulates tumor cell proliferation, cancer stem-like cells, and osteoclastic bone resorption PMID: 24468794
data may explain the association of the P72 variant and the CSF1/CSF1R pathway with increased senescence and radio-resistance in some epithelial tumor types PMID: 24019961
Pulsed ultrasound enhanced autocrine secretion of macrophage colony-stimulating factor (M-CSF), which subsequently activated the focal adhesion kinase (FAK) pathway to promote melanoblast migration. PMID: 23725022
The IL-4 pathway of proliferation may have developed as an alternative to CSF-1 to increase resident macrophage numbers without coincident monocyte recruitment. PMID: 24101381
the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined. PMID: 23260168
Differentiated signaling between IL-34 and CSF-1 is likely achieved by the relative thermodynamic independence of IL-34 versus negative cooperativity of CSF-1 at the CSF-1 receptor recognition sites. PMID: 22579672
Identify donor/recipient cell surface colony stimulating factor-1 signaling as promoter of neointimal formation in transplant-associated arteriosclerosis. PMID: 23117661
CSF-1-mediated expansion and polarization of resident renal macrophages/dendritic cells is an important mechanism mediating renal tubule epithelial regeneration after acute kidney injury. PMID: 23143303
Data suggest that membrane-bound CSF1 is not required for estrogen-deficiency bone loss; in contrast, soluble CSF1 isoform could play a key role in this pathologic process. PMID: 22105655
Study results provide a mechanistic explanation for the involvement of CSF-1 in glioblastoma progression and indicate that inhibition of CSF-1R signaling could provide a novel approach to limiting glioblastoma invasion PMID: 22294205
Postnatal neocortical expression showed that CSF-1 was expressed in layer VI, whereas IL-34 was expressed in the meninges and layers II-V. PMID: 22542597
CSF-1 deficiency decreased macrophage infiltration by approximately 50% during all stages of RT2 tumor progression. PMID: 21822305
Results point to a novel link between CSF-1 and osteocyte survival/function that is essential for maintaining bone mass and strength during skeletal development. PMID: 21958845
Intrarenal expression of csCSF-1 and spCSF-1 increases with advancing nephritis, thereby promoting the intrarenal recruitment of monocytes and expansion of Ly6C(hi) macrophages, which induce apoptosis of the renal parenchyma. PMID: 21885670
Coordinate regulation of tissue macrophage and dendritic cell population dynamics by CSF-1. PMID: 21825019
Matured macrophages by M-CSF play pivotal role by scavenging endotoxin in inflammation. PMID: 20189586
Splenic CSF-1-dependent F4/80-(highly expressed) Mac-1-(low expressing) macrophages (MPhis) are a subpopulation of red pulp MPhis that regulate peripheral immune homeostasis. PMID: 21239712
Granulocyte colony-stimulating factor enhances collateral artery growth and reduces infarct volume in a mouse model of brain ischemia, similarly to granulocyte-macrophage colony-stumulating factor (GM-CSF). PMID: 21257824
M-CSF-induced hepatic macrophages play an important role in liver regeneration after partial hepatectomy. PMID: 20031174
Data suggest that the CSF-1 pathway contributes to monocyte recruitment and macrophage survival and that this pathway is a potential target for therapeutic intervention. PMID: 20194110
The different spatiotemporal expression of IL-34 and CSF-1 allows for complementary activation of the CSF-1R in developing and adult tissues. PMID: 20504948
Transcriptional effects of colony-stimulating factor-1 in mouse macrophages. PMID: 19758725
Compressive force induces osteoclast differentiation by increasing M-CSF production and decreasing OPG production via PGE(2) in osteoblasts. PMID: 20001844
Genomic DNA from SB-induced astrocytoma tissue was extracted and transposon insertion sites were identified. Insertions in the growth factor gene Csf1 were found in 13 of the 21 tumors. PMID: 20388773
macrophage-colony-stimulating factor activates Src family kinases and Cbl proteins, and subsequently, induces NFATc1 degradation during osteoclast differentiation. PMID: 20037154
Studies demonstrated that increased CSF-1 production by host cells enhances TAM recruitment and NB growth. PMID: 19711348
Colony-stimulating factor 1 has a role in establishing early endometriotic lesions. PMID: 18990370

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.