Recombinant Mouse Mesothelin (MSLN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10477P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Mesothelin (MSLN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10477P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Mesothelin (MSLN) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q61468 |
Target Symbol | MSLN |
Synonyms | Msln; Mes; Mpf; Mesothelin; Pre-pro-megakaryocyte-potentiating factor) [Cleaved into: Megakaryocyte-potentiating factor; MPF); Mesothelin; cleaved form] |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS |
Expression Range | 298-600aa |
Protein Length | Partial |
Mol. Weight | 50.1kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) may potentiate megakaryocyte colony formation. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Golgi apparatus.; [Megakaryocyte-potentiating factor]: Secreted. |
Protein Families | Mesothelin family |
Database References | |
Tissue Specificity | Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level). |
Gene Functions References
- our findings show that Sulf-1 is an important tumor suppressor gene in hepatocellular carcinoma (HCC), and its over expression downregulates Msln and results in a decrease in HCC cell proliferation, migration, invasion, and lymphatic metastasis. PMID: 27626699
- Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis.( PMID: 28287406
- Results show that mouse mesothelin is similar to human mesothelin. Its stable overexpression in a pancreatic cancer cell line did not increase cell proliferation, suggesting that mesothelin is not necessarily a tumor progression factor. PMID: 26931187
- MSLN has an important role in the growth of lung cancer cells in vivo raising the possibility that inactivation of MPF may be a useful treatment for lung and other MSLN expressing cancers. PMID: 25118887
- The mesothelin expression promotes resistance to certain chemotherapy drugs such as TNF-alpha, paclitaxel, and a combination of platinum and cyclophosphamide. PMID: 22721387
- Mesothelin overexpression promotes mesothelioma cell invasion and MMP-9 secretion. PMID: 22371455
- Data show that mesothelin is a potential target in reducing resistance to cytotoxic drugs, and mesothelin-treated cells revealed rapid tyrosine phosphorylation of the p85 subunit of PI3K. PMID: 19747165
- binding of membrane-bound mesothelin to ovarian cancer antigen CA125 mediates heterotypic cell adhesion PMID: 14676194