Recombinant Mouse NGF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-2002P
Recombinant Mouse NGF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-2002P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P01139 |
Synonym | Beta nerve growth factor Beta NGF Beta-nerve growth factor Beta-NGF HSAN5 MGC161426 MGC161428 Nerve growth factor Nerve growth factor (beta polypeptide) Nerve growth factor beta Nerve growth factor beta polypeptide Nerve growth factor beta subunit NGF NGF_HUMAN NGFB NID67 |
Description | Recombinant Mouse NGF Protein (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVF RQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAW RFIRIDTACVCVLSRKATRRG |
Molecular Weight | 14 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The activity as determined by the proliferation of TF-1 cells and is typically less than 1 ng/ml. This corresponds to an expected specific activity of 1 x 106 units/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form. |
Subcellular Location | Secreted. Endosome lumen. |
Protein Families | NGF-beta family |
Database References | |
Tissue Specificity | Detected in submaxillary gland (at protein level). Highly expressed in male submaxillary gland. Levels are much lower in female submaxillary gland. |
Gene Functions References
- The authors described a long-distance signaling mechanism of Porcine hemagglutinating encephalomyelitis virus-driven deficits in neurons and suggested that such Ulk1 repression may result in limited NGF/TrkA retrograde signaling within activated Rab5 endosomes, explaining the progressive failure of neurite outgrowth and survival. PMID: 29875237
- Mechanoinsensitive ''silent'' nociceptors are characterized by the expression of the nicotinic acetylcholine receptor subunit alpha-3 (CHRNA3); the mechanically gated ion channel PIEZO2 mediates NGF-induced mechanosensitivity in these neurons. PMID: 29241539
- antibodies raised against NGF, TrkA, and p75 (also known as CD271) were used to explore the expression of these antigens in the non-decalcified young mouse femur. PMID: 29166838
- An inducible mouse model that can dissect the contribution of autocrine direct action of cleavage-resistant proNGF on systemic microvascular abnormalities in both retina and kidney, major targets for microvascular complication. PMID: 29253516
- both in vivo mechanical loading and in vitro mechanical stretch were shown to induce the profound up-regulation of NGF in osteoblasts within 1 h of loading. PMID: 28416686
- Nerve growth factor negatively regulates bone marrow granulopoiesis during small intestinal inflammation PMID: 26683342
- This study may represent a common mechanism for selective follicular activation induced by a localized increase in NGF in interstitial cells and mediated via the mTOR signaling pathway. PMID: 28542147
- nerve growth factor (NGF) signaling through neurotrophic tyrosine kinase receptor type 1 (TrkA) directs innervation of the developing mouse femur to promote vascularization and osteoprogenitor lineage progression. PMID: 27568565
- Mechanical stress-induced upregulation of NGF in colon SMC underlies the visceral hypersensitivity in bowel obstruction through increased gene expression and activity of tetrodotoxin-resistant Na channels in sensory neurons. PMID: 28079757
- results suggest that perivascular nerves innervate neovessels as neovasculatures mature and that NGF accelerates the innervation of perivascular nerves in neovessels. PMID: 27493098
- These findings reveal a non-neuronal role for neurotrophins and identify a new regulatory pathway in insulin secretion that can be targeted to ameliorate beta cell dysfunction. PMID: 27825441
- NGF signalling directly controls basal APP phosphorylation, subcellular localization and BACE cleavage. PMID: 27076121
- NGF facilitates OVA with lowLPS-induced maturation of mouse BMDCs through LPS-up-regulated p75 NTR via activation of NF-kappaB pathways, providing another mechanism for the involvement of NGF in the Th2 response PMID: 27437725
- NGF-OE mice exhibit age-dependent increases in Substance P and CGRP in the urothelium and hyperinnervation of the bladder. PMID: 27342083
- TNF-alpha upregulated Nerve Growth Factor [NGF] expression in synovial fibroblasts and macrophages and IL-1beta upregulated NGF expression in synovial fibroblasts. IL-1beta and TNF-alpha may regulate NGF signaling in Osteoarthritic joints and be suitable therapeutic targets for treating Osteoarthritis pain PMID: 27635406
- functional PAP(thorn) neurons are essential for the analgesic effect, which is mediated by NGF-trkA signaling. PMID: 27306411
- NGF negatively regulates growth cone retrograde actin flow on laminin. PMID: 26631553
- In E-Reeler retinas, NGF was significantly increased in retinal ganglion cells and glial cells. E-Reeler retinal bipolar cells and RGCs overexpress NGF and p75(NTR) as a protective endogenous response to Reelin deprivation. PMID: 26066836
- The NGF-induced up-regulation of TRPV1 via the increased synthesis and release of endogenous CGRP leads to improved cardiac performance in I/R-injured diabetic heart. PMID: 25650182
- NGF effects on parasympathetic nerves may regulate airway smooth muscle. PMID: 25647301
- Ginger extract has a synaptogenic effect via NGF-induced ERK/CREB activation, resulting in memory enhancement. PMID: 25049196
- Proinflammatory cytokines in osteoarthritis (OA) joints and the increased mechanical loading of cartilage may mediate OA pain via the stimulation of NGF expression and release by chondrocytes PMID: 24438745
- Despite being highly conserved, NGF and proNGF of mouse and human origins show distinct properties.Special care must be taken in performing experiments with cross-species systems. PMID: 25496838
- NGF exhibits anti-oxidative and hepatoprotective effects and is suggested to be therapeutically applicable in treating cholestatic liver diseases. PMID: 25397406
- Results indicate that analgesic effect of CB1 activation may in part be due to inhibition of NGF-induced sensitization of TRPV1 and also that the effect of CB1 activation is at least partly mediated by attenuation of NGF-induced increased PI3 signaling PMID: 25088915
- NGF induces removal of active caspase-3 in a lysosome-dependent manner. PMID: 24787014
- These results indicate that NGF exerts antileishmanial effect by stimulating hydrogen peroxide production in macrophages. PMID: 24937592
- iron accumulation induces NGF expression in hepatocytes, which in turn leads to LSEC defenestration via TrkA PMID: 25460199
- These findings suggest that overexpression of NGF in the ovary may suffice to cause both reproductive and metabolic alterations characteristic of polycystic ovary-like syndrome (PCOS) and support the hypothesis that sympathetic hyperactivity may contribute to the development and/or progression of PCOS. PMID: 25211588
- The increased NGF concentrations abolish Sema3A-induced inhibitory effect on axon outgrowth, while they have no effect on Sema3A-induced collapse rate. PMID: 24338202
- Data suggest that proNGF may appeal a new pathway or possible mechanism underlying microglial toxicity in the neuroinflammation and a potential target for therapeutic manipulation of the neurodegenerative diseases. PMID: 24040063
- beta-NGF gene transfection promotes the differentiation of bone marrow stromal stem cells into neurons through regulation of AKT and MAPKs signaling pathways. PMID: 23934089
- mechanical stimulation may attenuate NGFbeta signaling through Rac1 PMID: 23989259
- Independent of genotype, folate deficiency affects NGF levels in the frontal cortex, amygdala and hippocampus. PMID: 23623989
- calcineurin/NFAT pathway mediates the upregulation of PAI-1 by NGF PMID: 23825664
- ProNGF\NGF imbalance triggers learning and memory deficits, neurodegeneration and spontaneous epileptic-like discharges in transgenic mice. PMID: 23538417
- elevated levels of NGF in target tissues stimulate sympathetic and sensory axonal sprouting PMID: 23322532
- PIP5Kalpha acts as a negative regulator of nerve growth factor-induced neurite outgrowth by inhibiting PI3K/Akt signaling pathway in PC12 cells. PMID: 23538529
- Data suggest that diet factors (i.e., olive pomace polyphenols) up-regulate NGF/TrkA (proto-oncogene trk) and BDNF/TrkB (brain derived neurotrophic factor/receptor) in hippocampus/olfactory bulb and down-regulate NGF/BDNF in frontal cortex/striatum. PMID: 23466052
- Data suggest that expression of NGF is down-regulated in wounded skin (epidermis) in diabetes; among the growth factors investigated, only expression of NGF was down-regulated in healing skin wounds of diabetic mice as compared to nondiabetic mice. PMID: 23426701
- proNGF selectively promotes the growth of neurites from a subset of NGF-responsive neurons by a p75(NTR)-dependent mechanism during postnatal development when the axons of these neurons are ramifying within their targets in vivo PMID: 23633509
- Overexpression of mouse NGF in urothelium & detrusor affected transcription of PAC1, VPAC1, VPAC2, PAPCAP, VIP & other peptides normally & in cyclophosphamide-induced cystitis. The changes were tissue- and disease-duration dependent. PMID: 22700375
- The HTM1 heterodimer of 2 NGF muteins binds p75 and TrkA on opposite sides of the heterodimer, but not 2 TrkA receptors, supporting the ligand passing of NGF from p75 to TrkA via a transient heteroreceptor complex of p75-NGF-TrkA. PMID: 22903500
- Our results suggest that BDNF-TrkB but not NGF-TrkA signaling is involved in the brain repair after ICH, and early proper treadmill exercise might promote this repair process. PMID: 22999926
- Expression of NGF in hippocampus, cortex, and adrenal gland of wild type animal tended to decrease following spaceflight. PMID: 22808101
- This study demonstrated that both TrkA and NGF support the survival of only a subset of basal forebrain cholinergic neuron during brain development. PMID: 23100411
- Letter: NGF-p75 and neuropsin/KLK8 pathways may cooperate in regulation of epidermal homeostasis in inflamed skin. PMID: 22520925
- that NGF derived from bronchial and alveolar epithelium plays an important role in airway hyperresponsiveness after chronic exposure to mite antigen PMID: 22168511
- Therapeutic potential of NGF for the prevention of cardiomyopathy in diabetic subjects. PMID: 22187379
- NGF exerts profibrotic activities in the airways by inducing type III collagen production in fibroblasts PMID: 21816457