Recombinant Mouse Noggin Protein
Beta LifeScience
SKU/CAT #: BLA-1687P
Recombinant Mouse Noggin Protein
Beta LifeScience
SKU/CAT #: BLA-1687P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P97466 |
Synonym | Nog NOGG_HUMAN Noggin SYM 1 SYM1 Symphalangism 1 (proximal) Synostoses (multiple) syndrome 1 SYNS 1 SYNS1 |
Description | Recombinant Mouse Noggin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDP GFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFS EGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVG SCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIIS ECKCSC |
Molecular Weight | 46 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by its ability to inhibit 5.0 ng/mL of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/mL of Noggin. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |