Recombinant Mouse Osteopontin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1705P
Recombinant Mouse Osteopontin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1705P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P10923 |
Synonym | BNSP Bone sialoprotein 1 Bone sialoprotein I BSP I BSPI Early T lymphocyte activation 1 ETA 1 ETA1 MGC110940 Nephropontin OPN Osteopontin osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein OSTP_HUMAN PSEC0156 Secreted phosphoprotein 1 secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1) secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) SPP 1 SPP-1 SPP1 SPP1/CALPHA1 fusion Urinary stone protein Uropontin |
Description | Recombinant Mouse Osteopontin Protein (His tag) was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKD DFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSD ESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQY PDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLD EPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLV LDPKSKEDDRYLKFRISHELESSS |
Molecular Weight | 32 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.; Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity. |
Subcellular Location | Secreted. |
Protein Families | Osteopontin family |
Database References |
Gene Functions References
- The data of this study suggest that OPN is essential for proper astrocytic generation in vitro culture prepared from mouse cerebral cortex. PMID: 30246619
- Study shows that potent pro-inflammatory and pro-fibrotic molecules, osteopontin and galectin-3, are not major disease modulators of laminin alpha2 chain-deficient muscular dystrophy. PMID: 28281577
- Osteopontin activates the NF-kappaB pathway and accelerates the transfer and phosphorylation of p-NF-kappaB P65 from the cytoplasm to the nucleus. In the nucleus, p-NF-kappaB P65 regulates the transcription of genes encoding bone transcription factors, affecting osteogenesis and osteoclast synthesis and the secretion of bone-damaging factors, and ultimately leading to bone destruction. PMID: 30184545
- Study demonstrates that osteopontin has an essential role in modulating macrophage immunological profile and their ability to resist pathogenic forms of amyloid beta-protein. PMID: 28860067
- BSP and pyrophosphates work in concert to direct mineralization in cementum and likely other mineralized tissues. PMID: 28866368
- OPN deficiency has a protective effect against the progressive lipid deposition and glomerulosclerosis elicited by hypercholesterolemia. PMID: 27353458
- The present study demonstrated that OPN deficiency reduced intestinal absorption of cholesterol by suppressing the expression of NPC1L1, thus protecting mice from cholesterol gallstone formation. PMID: 28627641
- OPN regulates CYP7A1 levels and the metabolic fate of liver acetyl-CoA as a result of CHOL and PC metabolism interplay PMID: 28754826
- These results demonstrate that OPN expressed by fatigue-resistant/slow motor neurons is involved in the second-wave neurodegeneration by up-regulating MMP-9 through alphavbeta3 integrin in the mouse model of amyotrophic lateral sclerosis. PMID: 27264390
- Osteopontin is highly induced in carbon nanotube-exposed lungs and plays critical roles in TGF-beta1 signaling activation and myofibroblast differentiation to promote fibrosis development. PMID: 28595626
- The findings reveal that hepatic OPN contributes to cholesterol gallstone formation by regulating biliary metabolism and might be developed as a therapeutic target for gallstone treatments. PMID: 27484115
- Endogenous OPN emerges as a key player in the pathogenesis of chronic Chagas heart disease, through the upregulation of myocardial CCL5/MMP-2 expression and activities resulting in pro-inflammatory and pro-hypertrophic events, cardiac remodeling and interstitial fibrosis. PMID: 28987763
- In this study, the effect of deficiency of OPN on intestinal tumor development in Apc-deficient Min mice was investigated.At 16 weeks of age, the number of small intestinal polyps in Min/OPN(+/-) and Min/OPN(-/-) mice was lower than that of Min/OPN(+/+) mice. Colorectal tumor incidences and multiplicities in Min/OPN(+/-) and Min/OPN(-/-) mice were significantly lower than those in Min/OPN(+/+) mice PMID: 28505114
- Osteopontin RNA aptamer is a novel and effective approach for preventing cardiac hypertrophy and fibrosis, improving cardiac function, and reversing pressure overload-induced heart failure. PMID: 28453726
- OPN deficiency reduced the incidence of chemically induced HCC by suppressing EGFR-mediated anti-apoptotic signaling. PMID: 27888617
- In experimental autoimmune encephalomyelitis treated with interferon-beta, OPN was significantly decreased in splenocyte supernatants. Neutralizing OPN antibodies offset the inhibitory effect of IFN-beta on Th17 cells. IFN-beta influenced the acetylation of the Opn gene promoter. IFN-beta plays a role in Th17 differentiation partly through the inhibition of OPN. PMID: 29127843
- Osteopontin plays a key role in vascular smooth muscle cell via signaling pathways involving AP-1 and C/EBP beta, leading to increases in vascular smooth muscle cell proliferation and subsequent vascular remodeling. PMID: 27089830
- we disclosed the role of chemotaxis and apoptosis in the fibrotic microenvironment-enhanced seeding of tumor cells and identified the fibroblast-derived FN1 and SPP1 as the central mediators in these processes PMID: 27329720
- Data show that, together, osteocalcin (OC) and osteopontin (OPN) play important roles in determining bone size, shape, and strength. PMID: 29044594
- Results show that BSP and OPN are present in the mineralized tissues of fibrocartilaginous enthuses. PMID: 26826499
- AMPK was sufficient to stimulate osteogenesis of MC3T3-E1 cells and inhibit adipogenesis of 3T3-L1 cells through the AMPK-Gfi1-OPN axis. PMID: 27283242
- Excess osteopontin exacerbated sarcolemmal injury, and correspondingly, that loss of osteopontin reduced injury extent both in isolated myofibers and in muscle. PMID: 29065150
- A MMP-9-cleaved OPN fragment, OPN-32kDa, was responsible for inducing expansion of myeloid-derived suppressor cells, which may contribute to 3LL tumor's evasion of the immune response. PMID: 28986261
- OPN played a critical role in activating the migration of Mesenchymal stem cells to injured sites and their differentiation into specific skin cell types during skin wound healing. PMID: 28957406
- Findings demonstrate that claudin-low mammary tumor cells rely on OPN for proliferation, survival and migration as knockdown of OPN using siRNA inhibited proliferation and migration while increasing apoptosis. PMID: 27282619
- Intracellular OPN (iOPN) diminished the population size of myeloid progenitor cells and myeloid cells, and secreted OPN (sOPN) increase the population size of lymphoid cells. The total effect of OPN on skewing the leukocyte population balance was observed as host sensitivity to early systemic infection with Candida albicans and T cell-mediated colitis. PMID: 28671690
- this study shows that OPN promotes sepsis in Pseudomonas aeruginosa-infected mice and potentially blocks B cell-dependent immunity PMID: 28601359
- data suggest the possibility that Opn might regulate the homeostasis of intestinal microflora through maintenance of TCRgammadelta+ IELs, possibly by support of IEL survival PMID: 28296922
- OPN secreted by follicular CD153(+) senescence-associated T cells in germinal centers (GCs) promotes a continuous supply of intracellular autoantigens via apoptotic cells, thus playing a key role in the progression of the autoreactive GC reaction and leading to pathogenic autoantibody production in lupus-prone mice. PMID: 27534552
- study demonstrated an anti-tumorigenic role of OPN in transgenic adenocarcinoma of the mouse prostate (TRAMP) development and also suggests that the contribution of OPN to tumor development depends on the type of tumor as well as the source and isoform of OPN PMID: 27601131
- These data suggest a critical role for reduced stroma-derived osteopontin for hematopoietic stem cell aging. PMID: 28254837
- Osteopontin is a key mediator released by senescent pulmonary artery smooth muscle cells and contributes to pulmonary hypertension progression. PMID: 27444202
- Osteopontin (OPN) plays an anti-inflammatory role in acute gastrointestinal acute graft-versus-host disease (GVHD). PMID: 28192120
- Circulating OPN levels are upregulated in human and murine acute schistosomiasis. PMID: 27755536
- essential for the type I collagen secretion by newly differentiated odontoblast-like cells to form reparative dentin PMID: 27126446
- this study shows that neutrophil accumulation at the site of infection with a mixture of endodontic pathogens is significantly reduced in OPN-deficient mice, and is accompanied by an increase in bacterial load PMID: 27599164
- OPN ablation skews macrophage polarization toward a pro-regenerative phenotype. PMID: 27091452
- OPN induces oxidative stress via the involvement of mitochondria and NOX-4. It may affect mitochondrial morphology and integrity, at least in part, via the involvement of BIK. PMID: 27262843
- Endogenous osteopontin plays a critical role in the prevention of phosphate-induced nephrocalcinosis and vascular calcification in response to high phosphate load. PMID: 27083280
- GATA4 acts as a negative regulator of Bsp expression in osteoblasts. PMID: 26973342
- Genetic deletion of osteopontin in TRAMP mice skews prostate carcinogenesis from adenocarcinoma to aggressive human-like neuroendocrine cancers. PMID: 26700622
- IFN-gamma regulates hypertensive vascular collagen remodeling induced by ANG II and inhibits the differentiation of Th17 cells by suppressing OPN expression and regulating secretion of inflammatory cytokines. PMID: 26823760
- results indicate that autocrine OPN plays a crucial role in HPC expansion, migration, and subsequent oncogenic transformation of HPCs, which may provide a new insight into hepatocarcinogenesis PMID: 26033745
- OPN produced by hematogenous macrophages induces astrocyte process extension toward the infarct border zone, which may contribute to repair of the ischemic neurovascular unit following stroke PMID: 26148976
- During the priming phase of liver regeneration, osteopontin enhances the recruitment of macrophages and neutrophils, and triggers hepatocyte proliferation through Kupffer cell-derived IL-6 release and the downstream activation of Stat3. PMID: 26327817
- OPN deficiency accelerated the spontaneous development of colitis in mice with disrupted gut microbiota and macrophage phagocytic activity. PMID: 26274807
- mechanical stretch (MS) directly increased OPN protein expression and secretion in vascular smooth muscle cells. PMID: 25986148
- OPN may modulate psoriasis-like inflammation through altering lymphocyte distribution in skin and draining lymph nodes and by inducing IL-17 expression of inflammatory T cells. PMID: 25655893
- Osteopontin is expressed in the oviduct and promotes fertilization and preimplantation embryo development. PMID: 25263084
- BSP has a role in mouse cementum and craniofacial bone mineralization PMID: 25963390