Recombinant Mouse Osteopontin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-1705P

Recombinant Mouse Osteopontin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-1705P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P10923
Synonym BNSP Bone sialoprotein 1 Bone sialoprotein I BSP I BSPI Early T lymphocyte activation 1 ETA 1 ETA1 MGC110940 Nephropontin OPN Osteopontin osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein OSTP_HUMAN PSEC0156 Secreted phosphoprotein 1 secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1) secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) SPP 1 SPP-1 SPP1 SPP1/CALPHA1 fusion Urinary stone protein Uropontin
Description Recombinant Mouse Osteopontin Protein (His tag) was expressed in Yeast. It is a Protein fragment
Source Yeast
AA Sequence LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKD DFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSD ESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQY PDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLD EPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLV LDPKSKEDDRYLKFRISHELESSS
Molecular Weight 32 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.; Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity.
Subcellular Location Secreted.
Protein Families Osteopontin family
Database References

Gene Functions References

  1. The data of this study suggest that OPN is essential for proper astrocytic generation in vitro culture prepared from mouse cerebral cortex. PMID: 30246619
  2. Study shows that potent pro-inflammatory and pro-fibrotic molecules, osteopontin and galectin-3, are not major disease modulators of laminin alpha2 chain-deficient muscular dystrophy. PMID: 28281577
  3. Osteopontin activates the NF-kappaB pathway and accelerates the transfer and phosphorylation of p-NF-kappaB P65 from the cytoplasm to the nucleus. In the nucleus, p-NF-kappaB P65 regulates the transcription of genes encoding bone transcription factors, affecting osteogenesis and osteoclast synthesis and the secretion of bone-damaging factors, and ultimately leading to bone destruction. PMID: 30184545
  4. Study demonstrates that osteopontin has an essential role in modulating macrophage immunological profile and their ability to resist pathogenic forms of amyloid beta-protein. PMID: 28860067
  5. BSP and pyrophosphates work in concert to direct mineralization in cementum and likely other mineralized tissues. PMID: 28866368
  6. OPN deficiency has a protective effect against the progressive lipid deposition and glomerulosclerosis elicited by hypercholesterolemia. PMID: 27353458
  7. The present study demonstrated that OPN deficiency reduced intestinal absorption of cholesterol by suppressing the expression of NPC1L1, thus protecting mice from cholesterol gallstone formation. PMID: 28627641
  8. OPN regulates CYP7A1 levels and the metabolic fate of liver acetyl-CoA as a result of CHOL and PC metabolism interplay PMID: 28754826
  9. These results demonstrate that OPN expressed by fatigue-resistant/slow motor neurons is involved in the second-wave neurodegeneration by up-regulating MMP-9 through alphavbeta3 integrin in the mouse model of amyotrophic lateral sclerosis. PMID: 27264390
  10. Osteopontin is highly induced in carbon nanotube-exposed lungs and plays critical roles in TGF-beta1 signaling activation and myofibroblast differentiation to promote fibrosis development. PMID: 28595626
  11. The findings reveal that hepatic OPN contributes to cholesterol gallstone formation by regulating biliary metabolism and might be developed as a therapeutic target for gallstone treatments. PMID: 27484115
  12. Endogenous OPN emerges as a key player in the pathogenesis of chronic Chagas heart disease, through the upregulation of myocardial CCL5/MMP-2 expression and activities resulting in pro-inflammatory and pro-hypertrophic events, cardiac remodeling and interstitial fibrosis. PMID: 28987763
  13. In this study, the effect of deficiency of OPN on intestinal tumor development in Apc-deficient Min mice was investigated.At 16 weeks of age, the number of small intestinal polyps in Min/OPN(+/-) and Min/OPN(-/-) mice was lower than that of Min/OPN(+/+) mice. Colorectal tumor incidences and multiplicities in Min/OPN(+/-) and Min/OPN(-/-) mice were significantly lower than those in Min/OPN(+/+) mice PMID: 28505114
  14. Osteopontin RNA aptamer is a novel and effective approach for preventing cardiac hypertrophy and fibrosis, improving cardiac function, and reversing pressure overload-induced heart failure. PMID: 28453726
  15. OPN deficiency reduced the incidence of chemically induced HCC by suppressing EGFR-mediated anti-apoptotic signaling. PMID: 27888617
  16. In experimental autoimmune encephalomyelitis treated with interferon-beta, OPN was significantly decreased in splenocyte supernatants. Neutralizing OPN antibodies offset the inhibitory effect of IFN-beta on Th17 cells. IFN-beta influenced the acetylation of the Opn gene promoter. IFN-beta plays a role in Th17 differentiation partly through the inhibition of OPN. PMID: 29127843
  17. Osteopontin plays a key role in vascular smooth muscle cell via signaling pathways involving AP-1 and C/EBP beta, leading to increases in vascular smooth muscle cell proliferation and subsequent vascular remodeling. PMID: 27089830
  18. we disclosed the role of chemotaxis and apoptosis in the fibrotic microenvironment-enhanced seeding of tumor cells and identified the fibroblast-derived FN1 and SPP1 as the central mediators in these processes PMID: 27329720
  19. Data show that, together, osteocalcin (OC) and osteopontin (OPN) play important roles in determining bone size, shape, and strength. PMID: 29044594
  20. Results show that BSP and OPN are present in the mineralized tissues of fibrocartilaginous enthuses. PMID: 26826499
  21. AMPK was sufficient to stimulate osteogenesis of MC3T3-E1 cells and inhibit adipogenesis of 3T3-L1 cells through the AMPK-Gfi1-OPN axis. PMID: 27283242
  22. Excess osteopontin exacerbated sarcolemmal injury, and correspondingly, that loss of osteopontin reduced injury extent both in isolated myofibers and in muscle. PMID: 29065150
  23. A MMP-9-cleaved OPN fragment, OPN-32kDa, was responsible for inducing expansion of myeloid-derived suppressor cells, which may contribute to 3LL tumor's evasion of the immune response. PMID: 28986261
  24. OPN played a critical role in activating the migration of Mesenchymal stem cells to injured sites and their differentiation into specific skin cell types during skin wound healing. PMID: 28957406
  25. Findings demonstrate that claudin-low mammary tumor cells rely on OPN for proliferation, survival and migration as knockdown of OPN using siRNA inhibited proliferation and migration while increasing apoptosis. PMID: 27282619
  26. Intracellular OPN (iOPN) diminished the population size of myeloid progenitor cells and myeloid cells, and secreted OPN (sOPN) increase the population size of lymphoid cells. The total effect of OPN on skewing the leukocyte population balance was observed as host sensitivity to early systemic infection with Candida albicans and T cell-mediated colitis. PMID: 28671690
  27. this study shows that OPN promotes sepsis in Pseudomonas aeruginosa-infected mice and potentially blocks B cell-dependent immunity PMID: 28601359
  28. data suggest the possibility that Opn might regulate the homeostasis of intestinal microflora through maintenance of TCRgammadelta+ IELs, possibly by support of IEL survival PMID: 28296922
  29. OPN secreted by follicular CD153(+) senescence-associated T cells in germinal centers (GCs) promotes a continuous supply of intracellular autoantigens via apoptotic cells, thus playing a key role in the progression of the autoreactive GC reaction and leading to pathogenic autoantibody production in lupus-prone mice. PMID: 27534552
  30. study demonstrated an anti-tumorigenic role of OPN in transgenic adenocarcinoma of the mouse prostate (TRAMP) development and also suggests that the contribution of OPN to tumor development depends on the type of tumor as well as the source and isoform of OPN PMID: 27601131
  31. These data suggest a critical role for reduced stroma-derived osteopontin for hematopoietic stem cell aging. PMID: 28254837
  32. Osteopontin is a key mediator released by senescent pulmonary artery smooth muscle cells and contributes to pulmonary hypertension progression. PMID: 27444202
  33. Osteopontin (OPN) plays an anti-inflammatory role in acute gastrointestinal acute graft-versus-host disease (GVHD). PMID: 28192120
  34. Circulating OPN levels are upregulated in human and murine acute schistosomiasis. PMID: 27755536
  35. essential for the type I collagen secretion by newly differentiated odontoblast-like cells to form reparative dentin PMID: 27126446
  36. this study shows that neutrophil accumulation at the site of infection with a mixture of endodontic pathogens is significantly reduced in OPN-deficient mice, and is accompanied by an increase in bacterial load PMID: 27599164
  37. OPN ablation skews macrophage polarization toward a pro-regenerative phenotype. PMID: 27091452
  38. OPN induces oxidative stress via the involvement of mitochondria and NOX-4. It may affect mitochondrial morphology and integrity, at least in part, via the involvement of BIK. PMID: 27262843
  39. Endogenous osteopontin plays a critical role in the prevention of phosphate-induced nephrocalcinosis and vascular calcification in response to high phosphate load. PMID: 27083280
  40. GATA4 acts as a negative regulator of Bsp expression in osteoblasts. PMID: 26973342
  41. Genetic deletion of osteopontin in TRAMP mice skews prostate carcinogenesis from adenocarcinoma to aggressive human-like neuroendocrine cancers. PMID: 26700622
  42. IFN-gamma regulates hypertensive vascular collagen remodeling induced by ANG II and inhibits the differentiation of Th17 cells by suppressing OPN expression and regulating secretion of inflammatory cytokines. PMID: 26823760
  43. results indicate that autocrine OPN plays a crucial role in HPC expansion, migration, and subsequent oncogenic transformation of HPCs, which may provide a new insight into hepatocarcinogenesis PMID: 26033745
  44. OPN produced by hematogenous macrophages induces astrocyte process extension toward the infarct border zone, which may contribute to repair of the ischemic neurovascular unit following stroke PMID: 26148976
  45. During the priming phase of liver regeneration, osteopontin enhances the recruitment of macrophages and neutrophils, and triggers hepatocyte proliferation through Kupffer cell-derived IL-6 release and the downstream activation of Stat3. PMID: 26327817
  46. OPN deficiency accelerated the spontaneous development of colitis in mice with disrupted gut microbiota and macrophage phagocytic activity. PMID: 26274807
  47. mechanical stretch (MS) directly increased OPN protein expression and secretion in vascular smooth muscle cells. PMID: 25986148
  48. OPN may modulate psoriasis-like inflammation through altering lymphocyte distribution in skin and draining lymph nodes and by inducing IL-17 expression of inflammatory T cells. PMID: 25655893
  49. Osteopontin is expressed in the oviduct and promotes fertilization and preimplantation embryo development. PMID: 25263084
  50. BSP has a role in mouse cementum and craniofacial bone mineralization PMID: 25963390

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed