Recombinant Mouse PAI1 Protein
Beta LifeScience
SKU/CAT #: BLA-9995P
Recombinant Mouse PAI1 Protein
Beta LifeScience
SKU/CAT #: BLA-9995P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P22777 |
Synonym | Clade E Endothelial plasminogen activator inhibitor Nexin Nexin plasminogen activator inhibitor type 1 PAI PAI 1 PAI-1 PAI1_HUMAN PLANH1 Plasminogen activator inhibitor 1 Plasminogen activator inhibitor type 1 Serine (or cysteine) proteinase inhibitor Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serine proteinase inhibitor clade E member 1 serpin Serpin E1 Serpin peptidase inhibitor clade E Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serpine 1 SERPINE1 |
Description | Recombinant Mouse PAI1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMIND LLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVP MMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSAL TNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS ATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPT EMVIDRSFLFVVRHNPTETILFMGQVMEP |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | ab93068 is 80 (+/-) 5% active by uPA titration. The active fraction typically contains 70 percent active PAI1. Active concentration = ~2.0 mg/mL. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Serine protease inhibitor. Inhibits TMPRSS7. Is a primary inhibitor of tissue-type plasminogen activator (PLAT) and urokinase-type plasminogen activator (PLAU). As PLAT inhibitor, it is required for fibrinolysis down-regulation and is responsible for the controlled degradation of blood clots. As PLAU inhibitor, it is involved in the regulation of cell adhesion and spreading. Acts as a regulator of cell migration, independently of its role as protease inhibitor. It is required for stimulation of keratinocyte migration during cutaneous injury repair. Involved in cellular and replicative senescence. Plays a role in alveolar type 2 cells senescence in the lung. Is involved in the regulation of cementogenic differentiation of periodontal ligament stem cells, and regulates odontoblast differentiation and dentin formation during odontogenesis. |
Subcellular Location | Secreted. |
Protein Families | Serpin family |
Database References | STRING: 10090.ENSMUSP00000039586 UniGene: Mm.250422 |