Recombinant Mouse Prolactin/PRL Protein
Beta LifeScience
SKU/CAT #: BLA-2005P
Recombinant Mouse Prolactin/PRL Protein
Beta LifeScience
SKU/CAT #: BLA-2005P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P06879 |
Synonym | Decidual prolactin GHA1 Growth hormone A1 Lactogenic hormone Luteotropic hormone Mammotropin PRL Prolactin Prolactin precursor |
Description | Recombinant Mouse Prolactin/PRL Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMV KVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGV GGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQ LPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
Molecular Weight | 22 kDa |
Purity | >98% SDS-PAGE.>98% as determined by SDS-PAGE and HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat Nb2-11 cells is less than 1.0 ng/ml, corresponding to a specific activity of >1.0x106 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Prolactin acts primarily on the mammary gland by promoting lactation. |
Subcellular Location | Secreted. |
Protein Families | Somatotropin/prolactin family |
Database References | STRING: 10090.ENSMUSP00000105998 UniGene: Mm.1270 |