Recombinant Mouse Prolactin/PRL Protein
Beta LifeScience
SKU/CAT #: BLA-2006P
Recombinant Mouse Prolactin/PRL Protein
Beta LifeScience
SKU/CAT #: BLA-2006P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P06879 |
Synonym | Decidual prolactin GHA1 Growth hormone A1 Lactogenic hormone Luteotropic hormone Mammotropin PRL Prolactin Prolactin precursor |
Description | Recombinant Mouse Prolactin/PRL Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFM VKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITG VGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWS QLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
Molecular Weight | 23 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Prolactin acts primarily on the mammary gland by promoting lactation. |
Subcellular Location | Secreted. |
Protein Families | Somatotropin/prolactin family |
Database References | STRING: 10090.ENSMUSP00000105998 UniGene: Mm.1270 |