Recombinant Mouse Prominin-1 (PROM1) Protein (His-SUMO)

Name: Recombinant Mouse Prominin-1 (PROM1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03500P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Prominin-1 (PROM1) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O54990
Target Symbol	PROM1
Synonyms	Prom1; Prom; Proml1; Prominin-1; Antigen AC133 homolog; Prominin-like protein 1; CD antigen CD133
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN
Expression Range	509-794aa
Protein Length	Extracellular Domain
Mol. Weight	48.5kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
Subcellular Location	Apical cell membrane; Multi-pass membrane protein. Cell projection, microvillus membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Note=Found in extracellular membrane particles in various body fluids such as ventricular fluid of the developing brain and urine.
Protein Families	Prominin family
Database References	KEGG: mmu:19126 STRING: 10090.ENSMUSP00000073751 UniGene: Mm.6250
Tissue Specificity	In the submandibular gland, expressed on the apical side of epithelial cells. In the parotid gland, expressed in the intercalated ducts. In the sublingual gland, expressed in intercalated ducts. In the extraorbital lacrimal gland, expressed in the interca

Gene Functions References

Hypomyelination in CD133(-/-) mice was associated with fewer oligodendrocyte progenitor cells and mature oligodendrocytes. Behavioral analyses revealed that significantly impaired object recognition memory and altered Y-maze performance by CD133(-/-) mice compared with wild-type mice, suggesting perturbed cognitive performance. PMID: 29772232
Study evaluated the different components of the mouse subventricular zone (SVZ) during the first week after chemical induction of type 1 and type 2 diabetes-like (T1DM and T2DM) conditions. Only T2DM mice showed SVZ damage. The initial lesions were localized to ependymal cilia, which appeared disorientated and clumped together. In addition, they showed delocalization of the ciliary membrane protein prominin-1. PMID: 28743634
CD133-CD55- common progenitors are the main source of CXCL12 and Kitl producing cells in the developing marrow. PMID: 27929130
During biliary fibrosis Prominin-1-expressing progenitor cells transdifferentiate into cells within ductular reactions. This transdifferentiation may promote fibrosis. PMID: 28104292
findings clearly demonstrate that Wnt ligands produced by CD133+ DP cells play an important role in postnatal hair growth by maintaining the inductivity of DP cells and mediating the signaling cross-talk between the mesenchyme and the epithelial compartment PMID: 27462123
Prom1 positive pulmonary vascular endothelial cells can play a role in local pulmonary vascular homeostasis and repair. PMID: 27059286
High CD133 promoted stem-ness characteristics and metastasis potential in sphere-forming liver cancer stem cells. PMID: 26735577
Prom1+ dermal papilla(DP) cells do not contribute to dermal repair but are nevertheless capable of regulating DP size via beta-catenin-mediated intercellular communication. PMID: 26288357
These findings support PROM1 as a tumor cell-intrinsic marker related to glioblastoma survival, independent of its stem cell properties, and highlight potentially divergent roles for this protein in normal mouse and human glia. PMID: 25184684
The Prom1-knockout retina showed strong downregulation of expression of the visual cycle components, Rdh12 and Abca4 PMID: 25414197
Expansion of collagen-producing PROM1 positive cells within regions of periportal fibrosis is associated with activated fibroblast growth factor (FGF) and (TGF)beta pathways in biliary atresia. PMID: 24798639
CD133 is upregulated during neurogenesis. PMID: 23723983
CD133, a stem cell marker in mice: results in animal models cannot always be applied to human skin. PMID: 23495873
role of CD133 in growth of proneural glioma PMID: 23637986
In vivo tumor growth in NOD/SCID mouse xenografts of liver cancer stem cells were significantly repressed after CD133 silencing. PMID: 23233126
CD133 modifies frequencies of growth-factor responsive hematopoietic progenitor cells during steady state and after myelotoxic stress in vivo. PMID: 23509298
a net decrease in hippocampal neurogenesis, by 30% was found in Prominin-1 knock-out mice PMID: 23407958
Evidence for self-renewal capacity was obtained by serial transplantation of long-term epidermal repopulating units derived from CD133(+) and CD133(+)DeltaPsim(hi) keratinocytes. PMID: 22763787
CD133-positive glioma stem-like cells isolated from murine transplanted gliomas exhibit higher invasive potential after being cocultured with tumor-associated microglia/macrophages. PMID: 22664874
The microenvironment of the inflamed fibrotic lung impairs the regenerative capacity of bone marrow-derived prominin-1+ progenitor cells and promotes their differentiation into pathogenic phenotypes. PMID: 21943210
MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma PMID: 21931765
increased CD133 expression occurs at early stages of colon tumorigenesis in the mouse PMID: 22199291
Sox17 might be a key transcription factor controlling CD133 expression, and that it might also play a role in the control of gastric tumor progression. PMID: 21457403
Data reveal a novel, functional role for Prom1 that is not related to stem cell activity, and demonstrate the importance of tissue-specific characterization of putative stem cell markers. PMID: 21337465
CD133 positivity defines a genetically distinct cellular compartment in primary colorectal cancer cells PMID: 21435437
analysis of CD133/prominin in human and mouse cells PMID: 21187924
In addition to conserved expression of prominin-1 in photoreceptors, significant prominin-1-expressing non-photoreceptor retinal cell populations are present in the vertebrate eye. PMID: 21407811
Mouse prominin-1 is widely expressed in prostate whereas in human only some luminal cells express it PMID: 20717901
CD133, CD15/SSEA-1, and CD34 do not resume tumor-initiating properties of long-term cultured malignant glio-neuronal stem cells PMID: 20181261
CD133 may have a role in chemo-resistant Ewing sarcoma cells PMID: 20346143
the majority of mouse prominin-1 splice variants are widely expressed in mouse tissues PMID: 20808829
This study showed that resident microvascular CD133+ pericytes with presumptive stem cell potential are sensitive to spinal cord injury. PMID: 20374199
Our data show that CD133 expression is not selective for sphere forming, tumor-initiating or radioresistant subpopulations in the HCT-116 CRC cell lines. PMID: 19699546
prominin-1 is involved in the formation and/or stabilization of epididymal stereocilia and the tail of spermatozoa, and hence might play a dual role in the biogenesis of spermatozoa. PMID: 15316084
prominin-1/CD133 is expressed in embryonic stem cell-derived progenitors PMID: 15917475
colorectal cancer is created and propagated by a small number of undifferentiated tumorigenic CD133+ cells, which should therefore be the target of future therapies PMID: 17122771
We propose that the prominin-1/CD133 is a novel surface marker useful for collecting dermal papilla (DP) cells in the anagen stage and for analyzing the function of DP. PMID: 17185982
Apical midbodies of neuroepithelial cells concentrate prominin-1 (CD133), a somatic stem cell marker and defining constituent of a specific plasma membrane microdomain. PMID: 17283184
These data suggest that CD133-positive brown adipose tissue-derived cells are a useful tool as cardiomyocytes (CM) inducers, as well as a source of CMs. PMID: 17289932
expression of the marker Prominin-1 and in the three pairs of major salivary glands, i.e., submandibular-, major sublingual-, and parotid glands in mice PMID: 17874118
CD133(+) ependymal cells represent an additional-perhaps more quiescent-stem cell population in the mammalian forebrain PMID: 18195354
CD133 has roles in metastatic colon cancer and is expressed in colon cancer stem cells PMID: 18497883
CD133 expression is not restricted to intestinal stem or cancer-initiating cells, and during the metastatic transition, CD133+ tumor cells might give rise to the more aggressive CD133(- )subset, which is also capable of tumor initiation in NOD/SCID mice PMID: 18497886
Prominin-1+/CD133+ bone marrow-derived heart-resident cells suppress experimental autoimmune myocarditis. PMID: 18621802
CD133(+)CD44(+) population had the ability to produce colon tumor. PMID: 18663533
This study suggest that complex expression pattern of prominin-1 molecules in developing adult brain. Given that prominin-1 is thought to act as an organizer of plasma membrane protrusions. PMID: 19053060
data indicate that Prom1 marks stem cells in the adult small intestine that are susceptible to transformation into tumours retaining a fraction of mutant Prom1(+) tumour cells PMID: 19092805
CD133(+)CD45(-) oval cells isolated from premalignant 16-month-old Mat1a(-/-) mice demonstrated significant resistance to transforming growth factor-beta-induced apoptosis compared to CD133(-) cells. PMID: 19115422
Loss of Prom-1 results in progressive degeneration of mature photoreceptors with complete loss of vision. PMID: 19228982
Data suggest the possibility that CD133 may be specifically down-regulated during G0/G1, and this should be considered when this marker is used to identify and isolate other tissue and cancer stem cells. PMID: 19430532

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.