Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc)

Name: Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01906P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P04426
Target Symbol	WNT1
Synonyms	Proto-oncogene Int-1
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	ANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
Expression Range	28-370aa
Protein Length	Full Length of Mature Protein
Mol. Weight	45.8 kDa
Research Area	Stem Cells
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Plays an essential role in the development of the embryonic brain and central nervous system (CNS). Has a role in osteoblast function, bone development and bone homeostasis.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families	Wnt family
Database References	KEGG: mmu:22408 STRING: 10090.ENSMUSP00000023734 UniGene: Mm.1123
Tissue Specificity	Testis and mid-gestational embryos. In the testis, detected only in postmeiotic germ cells undergoing differentiation from round spermatids into mature spermatozoa. In the embryos, expression is restricted to the developing CNS in regions of the neural tu

Gene Functions References

aberrant expression of AF1q may activate Wnt/beta-catenin signaling and result in podocyte injury. PMID: 29069662
Wnt1a maintains characteristics of dermal papilla cells that induce mouse hair regeneration in a 3D preculture system PMID: 26118627
These data suggested that Wnt/beta-catenin pathway might be a potential target to treat the LPS-induced inflammation in ALI. PMID: 29246763
Wnt signaling regulates airway epithelial stem cells in adult murine submucosal glands. PMID: 27341073
Pax9-dependent Wnt signaling has a role in palatogenesis and cleft palates PMID: 28893947
Data show that autocrine Wnt secretion is important for the survival, chromosomal stability, differentiation, and tumorigenic potential of embryonic stem cells (ESCs). PMID: 28074006
Results demonstrated functional differences in the molecular mechanisms downstream of Wnt1 function in the diencephalon, in relation to the spinal cord. Wnt1 signal determines the patterning of the diencephalic dorso-ventral axis PMID: 26452989
Data show that both transgenic Wnt1-cre and P0-cre are similarly effective in deleting beta-catenin in the neural crest. PMID: 27184910
data suggest that WNT1-related osteogenesis imperfecta and osteoporosis are caused in part by decreased mTORC1-dependent osteoblast function resulting from loss of WNT1 signaling in osteocytes. PMID: 28628032
Administration of EET alters Wnt1, NOV, and HO-1 signaling to prevent obesity-induced cardiomyopathy in obese mice. PMID: 28576832
Data indicate that Wnt1 proto-oncogene protein (WNT1) is the direct target of microRNA miR-34a in dendritic cell (DC). PMID: 28199987
The data obtained from the 14-3-3epsilon/14-3-3zeta/Wnt1-Cre mice strongly indicate the importance of 14-3-3 proteins in the development of melanocyte lineages. PMID: 27001213
High WNT1 promoted stem-ness characteristics and metastasis potential in sphere-forming liver cancer stem cells. PMID: 26735577
Decreased expressions of Wnt1 and Wnt5a. PMID: 26537990
we provide unequivocal evidence that epithelial-derived Wnt1 is sufficient to drive interstitial fibrosis in the absence of any injury. PMID: 26204899
Data show that elongator protein 3 (Elp3) trigger Wnt-driven tumor initiation in the intestine, and Elp3 deficiency strongly impaired radiation-induced intestinal regeneration. PMID: 26527802
Fasudil prevents loss of dopamine neurons in the MPTP mice model of PD through inflammatory inhibition via activation of PI3K/p-Akt and WNT1/Fzd1/beta-catenin cell signaling pathways. PMID: 26045742
Wnt has a role in striatal synaptic degeneration and impaired motor behavior in adult mice PMID: 25318560
Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway. PMID: 25677507
this study gives new insights into transcriptional regulating mechanisms of Wnt-mediated Isl1 expression during cardiomyocyte differentiation. PMID: 24610003
Data show that bone marrow mesenchymal stem cell (BM-MSC)-generated Wnt1a promotes the dermal papilla's ability to induce hair cycling and regeneration. PMID: 24961246
modulates neuronal function, hippocampal neurogenesis, and synaptic plasticity and that downregulation of Wnt signaling could be involved in the cognitive decline associated with aging and also with the physiopathology of Alzheimer's disease (AD). PMID: 25443287
BECN1 suppresses mammary tumorigenesis driven by WNT1 activation and following parity PMID: 25483966
in the absence of retinoid signaling via RARbeta, reduced IGF-1 signaling results in suppression of epithelial-mesenchymal transition and delays tumorigenesis induced by the Wnt1 oncogene PMID: 25422594
results revealed that in Wnt-driven tumors, an attenuation of IGF1R signaling accelerates tumorigenesis and promotes more aggressive phenotypes with potential implications for understanding TNBC pathobiology and treatment PMID: 25092896
The swaying mouse is a model of osteogenesis imperfecta caused by WNT1 mutations. PMID: 24634143
Results indicate an important role for the canonical Wnt/beta-catenin pathway in the dendritic cells (DCs)-mediated regulation of allergic responses in the lung. PMID: 24929002
a broader role for Wnt/beta-catenin signaling in contributing to progenitor cell proliferation in nonhairy epithelia and interfollicular epidermis under homeostasis, is reported. PMID: 24315444
Wnt activation, rather than mature hair follicles, is required for adipocyte generation in murine epidermis. PMID: 24706781
Concomitant expression of Wnt1 and KRASG12D in pancreatic epithelium stimulates development of mucinous cystic neoplasm (MCN)-like lesions in female mice. PMID: 24067880
The results indicate the involvement of Wnt1 and Fzd1 in the pathogenesis and development of amyotrophic lateral sclerosis. PMID: 23553522
Marked elevation of Wnt1 expression in the ventral midbrain is correlated with disruption of the differentiation program of ventral dopaminergic neurons. PMID: 23648512
WNT signaling, which is important in developmental processes of the nervous system, plays a critical role in neuropathic pain after sciatic nerve injury and bone cancer in rodents PMID: 23585476
Lgr4 is critically involved in the maintenance of intestinal homeostasis and protection against inflammatory bowel disease through modulation of the Wnt/beta-catenin signaling pathway PMID: 23393138
Axin2-positive tympanic border cells are Wnt responsive and can act as precursors to sensory epithelial cells in the postnatal cochlea. PMID: 23444352
The spatial and temporal function of Wnt1 in midbrain and cerebellum patterning and in midbrain dopamine neuron development in vivo. PMID: 23444360
Wnt1 and Wnt5a interact genetically and cooperate to promote midbrain DA neuron development in vivo. PMID: 23324743
Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein PMID: 23152495
cyclin-dependent kinase 2-associated protein 1 (CDK2AP1), an essential gene for early embryonic development, plays a role in pluripotency of ESC by engaging MBD3 to the promoter region of Wnt signaling genes PMID: 23074223
Wnt1cre/Dicer mice fail to develop neural crest-derived cartilages, therefore, have no middle ear ossicles. PMID: 22778034
Low-dose radiation stimulates neural stem cell proliferation, neurogenesis in the hippocampus, and animal learning, by triggering Wnt/beta-catenin signaling cascades. PMID: 22272614
these results suggest that Wnt1 could enhance tumorigenesis by conferring stem cell properties on breast cancer cells PMID: 22846569
Wnt1 is anti-lymphangiogenic by suppressing melanoma-derived VEGF-C expression. PMID: 22572818
The balancing act between cell proliferation and mucus production to restore barrier integrity seems to depend upon the interplay between the Wnt/beta-catenin and Notch pathways in the transmissible murine colonic hyperplasia model. PMID: 22710872
Dickkopf2 is a Wnt antagonist involved in regulation of glucose metabolism PMID: 22733757
GSK3beta plays an essential role in Ras degradation and inhibition of this degradation pathway by aberrant Wnt/beta-catenin signaling may contribute to Ras-induced transformation in colorectal tumorigenesis PMID: 22494971
Wnt1 expression is related to molecular identity and cell migration in cerebellum development in mice. PMID: 22173107
dermal Wnt signaling/beta-catenin has roles in fibroblast proliferation and in the epidermal hair follicle initiation program PMID: 22434869
lipid modification of Wnt1 is required for Wnt secretion, but not stability PMID: 22046319
Acute ischaemic cardiac injury upregulates Wnt1 in the epicardium & later by fibroblasts in the region of injury. Wnt1 induces them to proliferate & express pro-fibrotic genes. PMID: 22085926

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.