Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01906P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01906P
Collections: Cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Proto-Oncogene Wnt-1 (WNT1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P04426 |
Target Symbol | WNT1 |
Synonyms | Proto-oncogene Int-1 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | ANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL |
Expression Range | 28-370aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 45.8 kDa |
Research Area | Stem Cells |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Plays an essential role in the development of the embryonic brain and central nervous system (CNS). Has a role in osteoblast function, bone development and bone homeostasis. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. Secreted. |
Protein Families | Wnt family |
Database References | |
Tissue Specificity | Testis and mid-gestational embryos. In the testis, detected only in postmeiotic germ cells undergoing differentiation from round spermatids into mature spermatozoa. In the embryos, expression is restricted to the developing CNS in regions of the neural tu |
Gene Functions References
- aberrant expression of AF1q may activate Wnt/beta-catenin signaling and result in podocyte injury. PMID: 29069662
- Wnt1a maintains characteristics of dermal papilla cells that induce mouse hair regeneration in a 3D preculture system PMID: 26118627
- These data suggested that Wnt/beta-catenin pathway might be a potential target to treat the LPS-induced inflammation in ALI. PMID: 29246763
- Wnt signaling regulates airway epithelial stem cells in adult murine submucosal glands. PMID: 27341073
- Pax9-dependent Wnt signaling has a role in palatogenesis and cleft palates PMID: 28893947
- Data show that autocrine Wnt secretion is important for the survival, chromosomal stability, differentiation, and tumorigenic potential of embryonic stem cells (ESCs). PMID: 28074006
- Results demonstrated functional differences in the molecular mechanisms downstream of Wnt1 function in the diencephalon, in relation to the spinal cord. Wnt1 signal determines the patterning of the diencephalic dorso-ventral axis PMID: 26452989
- Data show that both transgenic Wnt1-cre and P0-cre are similarly effective in deleting beta-catenin in the neural crest. PMID: 27184910
- data suggest that WNT1-related osteogenesis imperfecta and osteoporosis are caused in part by decreased mTORC1-dependent osteoblast function resulting from loss of WNT1 signaling in osteocytes. PMID: 28628032
- Administration of EET alters Wnt1, NOV, and HO-1 signaling to prevent obesity-induced cardiomyopathy in obese mice. PMID: 28576832
- Data indicate that Wnt1 proto-oncogene protein (WNT1) is the direct target of microRNA miR-34a in dendritic cell (DC). PMID: 28199987
- The data obtained from the 14-3-3epsilon/14-3-3zeta/Wnt1-Cre mice strongly indicate the importance of 14-3-3 proteins in the development of melanocyte lineages. PMID: 27001213
- High WNT1 promoted stem-ness characteristics and metastasis potential in sphere-forming liver cancer stem cells. PMID: 26735577
- Decreased expressions of Wnt1 and Wnt5a. PMID: 26537990
- we provide unequivocal evidence that epithelial-derived Wnt1 is sufficient to drive interstitial fibrosis in the absence of any injury. PMID: 26204899
- Data show that elongator protein 3 (Elp3) trigger Wnt-driven tumor initiation in the intestine, and Elp3 deficiency strongly impaired radiation-induced intestinal regeneration. PMID: 26527802
- Fasudil prevents loss of dopamine neurons in the MPTP mice model of PD through inflammatory inhibition via activation of PI3K/p-Akt and WNT1/Fzd1/beta-catenin cell signaling pathways. PMID: 26045742
- Wnt has a role in striatal synaptic degeneration and impaired motor behavior in adult mice PMID: 25318560
- Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway. PMID: 25677507
- this study gives new insights into transcriptional regulating mechanisms of Wnt-mediated Isl1 expression during cardiomyocyte differentiation. PMID: 24610003
- Data show that bone marrow mesenchymal stem cell (BM-MSC)-generated Wnt1a promotes the dermal papilla's ability to induce hair cycling and regeneration. PMID: 24961246
- modulates neuronal function, hippocampal neurogenesis, and synaptic plasticity and that downregulation of Wnt signaling could be involved in the cognitive decline associated with aging and also with the physiopathology of Alzheimer's disease (AD). PMID: 25443287
- BECN1 suppresses mammary tumorigenesis driven by WNT1 activation and following parity PMID: 25483966
- in the absence of retinoid signaling via RARbeta, reduced IGF-1 signaling results in suppression of epithelial-mesenchymal transition and delays tumorigenesis induced by the Wnt1 oncogene PMID: 25422594
- results revealed that in Wnt-driven tumors, an attenuation of IGF1R signaling accelerates tumorigenesis and promotes more aggressive phenotypes with potential implications for understanding TNBC pathobiology and treatment PMID: 25092896
- The swaying mouse is a model of osteogenesis imperfecta caused by WNT1 mutations. PMID: 24634143
- Results indicate an important role for the canonical Wnt/beta-catenin pathway in the dendritic cells (DCs)-mediated regulation of allergic responses in the lung. PMID: 24929002
- a broader role for Wnt/beta-catenin signaling in contributing to progenitor cell proliferation in nonhairy epithelia and interfollicular epidermis under homeostasis, is reported. PMID: 24315444
- Wnt activation, rather than mature hair follicles, is required for adipocyte generation in murine epidermis. PMID: 24706781
- Concomitant expression of Wnt1 and KRASG12D in pancreatic epithelium stimulates development of mucinous cystic neoplasm (MCN)-like lesions in female mice. PMID: 24067880
- The results indicate the involvement of Wnt1 and Fzd1 in the pathogenesis and development of amyotrophic lateral sclerosis. PMID: 23553522
- Marked elevation of Wnt1 expression in the ventral midbrain is correlated with disruption of the differentiation program of ventral dopaminergic neurons. PMID: 23648512
- WNT signaling, which is important in developmental processes of the nervous system, plays a critical role in neuropathic pain after sciatic nerve injury and bone cancer in rodents PMID: 23585476
- Lgr4 is critically involved in the maintenance of intestinal homeostasis and protection against inflammatory bowel disease through modulation of the Wnt/beta-catenin signaling pathway PMID: 23393138
- Axin2-positive tympanic border cells are Wnt responsive and can act as precursors to sensory epithelial cells in the postnatal cochlea. PMID: 23444352
- The spatial and temporal function of Wnt1 in midbrain and cerebellum patterning and in midbrain dopamine neuron development in vivo. PMID: 23444360
- Wnt1 and Wnt5a interact genetically and cooperate to promote midbrain DA neuron development in vivo. PMID: 23324743
- Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein PMID: 23152495
- cyclin-dependent kinase 2-associated protein 1 (CDK2AP1), an essential gene for early embryonic development, plays a role in pluripotency of ESC by engaging MBD3 to the promoter region of Wnt signaling genes PMID: 23074223
- Wnt1cre/Dicer mice fail to develop neural crest-derived cartilages, therefore, have no middle ear ossicles. PMID: 22778034
- Low-dose radiation stimulates neural stem cell proliferation, neurogenesis in the hippocampus, and animal learning, by triggering Wnt/beta-catenin signaling cascades. PMID: 22272614
- these results suggest that Wnt1 could enhance tumorigenesis by conferring stem cell properties on breast cancer cells PMID: 22846569
- Wnt1 is anti-lymphangiogenic by suppressing melanoma-derived VEGF-C expression. PMID: 22572818
- The balancing act between cell proliferation and mucus production to restore barrier integrity seems to depend upon the interplay between the Wnt/beta-catenin and Notch pathways in the transmissible murine colonic hyperplasia model. PMID: 22710872
- Dickkopf2 is a Wnt antagonist involved in regulation of glucose metabolism PMID: 22733757
- GSK3beta plays an essential role in Ras degradation and inhibition of this degradation pathway by aberrant Wnt/beta-catenin signaling may contribute to Ras-induced transformation in colorectal tumorigenesis PMID: 22494971
- Wnt1 expression is related to molecular identity and cell migration in cerebellum development in mice. PMID: 22173107
- dermal Wnt signaling/beta-catenin has roles in fibroblast proliferation and in the epidermal hair follicle initiation program PMID: 22434869
- lipid modification of Wnt1 is required for Wnt secretion, but not stability PMID: 22046319
- Acute ischaemic cardiac injury upregulates Wnt1 in the epicardium & later by fibroblasts in the region of injury. Wnt1 induces them to proliferate & express pro-fibrotic genes. PMID: 22085926