Recombinant Mouse PVRIG/CD112R Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10747P
Recombinant Mouse PVRIG/CD112R Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10747P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | A0A1B0GS01 |
Synonym | Poliovirus receptor-related immunoglobulin domain-containing protein PVRIG PVRIG_HUMAN Transmembrane protein PVRIG |
Description | Recombinant Mouse PVRIG/CD112R Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAV LHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVT FPHGSRVACRDLHRSDPGLSAPTPALNLQAD |
Molecular Weight | 41 kDa including tags |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |