Recombinant Mouse Resistin (RETN) Protein (His)

Name: Recombinant Mouse Resistin (RETN) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03632P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Retn.

Collections: Cytokines, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Resistin (RETN) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q99P87
Target Symbol	RETN
Synonyms	Retn; Fizz3; Resistin; Adipose tissue-specific secretory factor; ADSF; Adipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Expression Range	21-114aa
Protein Length	Full Length of Mature Protein
Mol. Weight	14.2kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Subcellular Location	Secreted.
Protein Families	Resistin/FIZZ family
Database References	KEGG: mmu:57264 STRING: 10090.ENSMUSP00000012849 UniGene: Mm.1181
Tissue Specificity	Expressed in white but not brown adipose tissue in a variety of organs.

Gene Functions References

Resistin inhibited the activation of CREB, resulting in suppression of PGC-1alpha. Importantly, overexpressing PGC-1alpha can rescue the inhibitory effects of resistin on fatty acid beta oxidation. PMID: 29730652
Resistin-associated VSMC dysfunction and intimal hyperplasia are related to PKCepsilon-dependent Nox activation and ROS generation PMID: 27573736
OLI is a physiological repressor of systemic resistin release whereas FFA upregulate resistin release in vitro from adipocytes. PMID: 26285069
Resistin possibly acts via an intracrine pathway as an intracellular sensor, regulating the adipocyte insulin sensitivity. PMID: 26036220
Mouse Resistin has regulative effects on murine bone marrow hematopoiesis. PMID: 26572487
murine resistin is increased in the lungs of wild-type mice following acute ozone exposure but does not promote ozone-induced lung pathology. PMID: 26386120
Inhibition of miR-696 restored the triglycerides content by up to 80%, which suggests that, in C2C12 cells, resistin at least partially increases the deposition of lipids through miR-696. PMID: 25962325
Antiresistin RNA oligo ameliorated metabolic abnormalities and histopathology of nonalcoholic fatty liver disease through attenuating proinflammatory cytokines PMID: 25922835
Resistin regulates PAI-1 expression in 3T3-L1 adipocytes via Akt phosphorylation. PMID: 24667608
Oxidized-LDL promotes the expression and secretion of visfatin and resistin through its activation of endoplasmic reticulum stress. PMID: 24278099
ET type-A receptor, ERK1/2, JNKs, AKT, and JAK2, but not ET type-B receptor or p38, are necessary for the ET-1 stimulation of resistin gene expression PMID: 24424064
resistin is a negative regulator of SIRT1 in both human hepatoma cell line HepG2 and mouse hepatocytes. PMID: 23827175
Both resistin gene expression and its secretion from the epididymal adipose tissue were decreased in db/db obese mice, while the insulin-sensitizing drug rosiglitazone increased resistin production. PMID: 23776497
lipid content was significantly decreased in 3T3-L1 cells transfected with anti-resistin small interfering RNA (siRNA) after adipocyte differentiation PMID: 24034627
The effect between resistin and adiponectin on the proliferation of vascular smooth muscle cells (VSMCs), was investigated. PMID: 23267839
The current study was initiated to determine whether resistin has additional roles in glucose-dependent insulinotropic polypeptide -regulated adipocyte functions. PMID: 23002036
significant changes in fasting-induced adipose factor (FIAF), resistin (Rstn), long-form leptin receptor (LepRb) and suppressor of cytokine-3 (SOCS3) gene expression following chronic SCI and with advanced age PMID: 22815920
results identify resistin as a potential inhibitory ligand for the receptor ROR1 and demonstrate, for the first time, that ROR1 plays an important role in adipogenesis and glucose homeostasis in 3T3-L1 cellsand glucose homeostasis in 3T3-L1 cells. PMID: 22074948
Cleavage product of decorin serves as a functional receptor of resistin in adipocyte progenitors and may regulate white adipose tissue expansion. PMID: 21683670
review of evidence that resistin (secreted by adipocytes in the mouse) is an inflammatory biomarker and a potential mediator of obesity, diabetes and cardiovascular disease [REVIEW] PMID: 21497511
Valsartan did not alter resistin expression in the ob/ob mouse. PMID: 20472602
Data suggest that s-resistin isoform may play a role in inflammatory processes. PMID: 20627112
data suggest that endogenous resistin might be capable of fine-tuning the expression and enzymatic activity of various hypothalamic targets previously implicated in the delicate homeostatic control of food intake PMID: 19646421
Tumor necrosis factor alpha is a negative regulator of resistin gene expression and secretion in 3T3-L1 adipocytes PMID: 11689013
Mechanisms regulating adipocyte expression of resistin PMID: 11901161
examined the effect on resistin expression of various hormones and cytokines known to affect insulin sensitivity. PMID: 12031960
Data demonstrate that basal and hormonal stimulation of resistin secretion by insulin is inhibited by ET-1. PMID: 12163029
results indicate that the substantial reduction of adiposity in lactation does not lead to any changes in resistin gene expression in white adipose tissue PMID: 12163041
expression and regulation in mouse pituitary; data suggest that local resistin expression could have functional implications during prepubertal maturation of the hypothalamic-pituitary system PMID: 12208498
during in vivo bone formation and remodeling, probably acting as a co-factor or accessory protein that modulates the effects of primary signaling molecules PMID: 12413946
Resistin expression is regulated by C-EBP Proteins, peroxisome proliferator-activated receptor, and signal-transducing molecules. PMID: 12437985
Resistin is regulated and expressed in mouse brown adipocytes PMID: 12482590
resistin does not alter insulin receptor signaling but does affect insulin-stimulated glucose uptake, presumably by decreasing the intrinsic activity of cell surface glucose transporters PMID: 12618360
ADSF/resistin secretion controls fat cell differentiation and adipose tissue development. PMID: 12660879
Despite severe weight loss and significant falls in leptin expression and insulin concentration, resistin gene expression appears unchanged in white adipose tissue of mice with MAC16 tumour. PMID: 12660881
Data show that neuropeptie Y significantly increased resistin mRNA expression in white adipose tissue compared with artificial cerebrospinal fluid treated controls. PMID: 12684710
resistin is a novel secreted factor first identified as a TZD-suppressible gene PMID: 12700889
results demonstrate that leptin decreases resistin expression and suggest that resistin may influence glucose homeostasis PMID: 14962997
mice lacking resistin exhibit low blood glucose levels after fasting, due to reduced hepatic glucose production; data support a physiological function for resistin in the maintenance of blood glucose during fasting PMID: 14976316
Inhibits insulin-stimulaed glucose uptake into skeletal muscle cells without affecting insulin signaling pathways. Review. PMID: 15055467
demonstrates in vivo the inhibitory role of ADSF in adipogenesis PMID: 15090646
Pituitary resistin expression is age- and gender-dependent. In ob/ob and fasted mice, resistin is regulated in a tissue-specific manner. Visceral fat obesity increases but starvation decreases resistin mRNA. PMID: 15103228
Plasma resistin of leptin-treated mice was barely decreased. PMID: 15126241
Chronic hyperresistinemia impairs normal glucose metabolism. PMID: 15189975
Nutritional regulation of resistin and changes in resistin gene expression and circulating levels in obesity are mediated, at least in part, through insulin and glucose. PMID: 15220189
results indicate that chronic "hyper-resistinemia" leads to whole-body insulin resistance involving impaired insulin signaling in skeletal muscle, liver, and adipose tissue, resulting in glucose intolerance, hyperinsulinemia, and hypertriglyceridemia PMID: 15254589
These results provide strong support for a physiological role of resistin in the development of hepatic insulin resistance. PMID: 15254590
Article reviews recent studies of Resistin/ADSF/FIZZ3 in transgenic and knockout mice. PMID: 15358276
Resistin overexpression induces dyslipidemia in mice, which is commonly seen in the insulin-resistant state, partially through enhanced secretion of lipoproteins. PMID: 15471967
gender differences in resistin, adiponectin and leptin mRNA expression and plasma levels were not ablated by castration and seem to be dependent on other factors in addition to gonadal steroids PMID: 15483213

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.