Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active

Name: Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05758P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/ml can bind Mouse Rbp4, the EC 50 is 38.07-75.83 ng/mL. Biological Activity Assay

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC 50 is 38.07-75.83 ng/mL.
Uniprotkb	Q00724
Target Symbol	RBP4
Synonyms	(Plasma retinol-binding protein)(PRBP)(RBP)
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
Expression Range	19-201aa
Protein Length	Full Length of Mature Protein
Mol. Weight	50.3 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Subcellular Location	Secreted.
Protein Families	Calycin superfamily, Lipocalin family
Database References	KEGG: mmu:19662 STRING: 10090.ENSMUSP00000025951 UniGene: Mm.2605

Gene Functions References

RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085
RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
New insights into ghrelin cell physiology, and given the known functions of RBP4 and TTR, support an emerging role for the ghrelin cell in blood glucose handling and metabolism. PMID: 23840311
Retinal degeneration in RBP4-Tg mice is RBP4-dependent and light-independent. PMID: 28813718
Rbp4-deficient mice accumulated retinol in the liver but it was undetectable in the serum, indicating an inverse relation between serum and liver retinol levels. RBP4 is critical for the mobilization of retinol from hepatic storage pools, and such mobilization is necessary for ocular development and visual function. PMID: 26974396
Hepatocytes Are the Principal Source of Circulating RBP4 in Mice PMID: 27797907
RBP4 may be a critical modulator promoting the vicious cycle of insulin resistance and heart failure by activating TLR4/MyD88-mediated inflammatory pathways. Potentially, lowering RBP4 might break the vicious cycle and improve both insulin resistance and cardiac hypertrophy. PMID: 27100622
Data (including data from studies in knockout mice) suggest that Rbp4 (plasma retinol-binding protein 4) is critical for antigen presentation and activation of CD4-positive T-lymphocyte in development of insulin resistance in mice obese due to high-fat diet. PMID: 26936962
A novel mechanism for circadian regulation of RBP4, but also a critical role of RBP4, acting as a hepatokine in the regulation of glucose metabolism by the circadian clock. PMID: 26564180
Elevated serum RBP4 raises BP. PMID: 25911613
These data show that decreasing circulating TTR levels or altering TTR-RBP4 binding could be a potential therapeutic approach for the treatment of type 2 diabetes. PMID: 25524914
findings suggest that RBP4 impaired in vivo adipogenesis, partly through the repression of the insulin pathway PMID: 24590924
The data implicate the involvement of chondrocytic Rbp4 in bone growth, particularly in the formation of the secondary ossification center of the limb. PMID: 23224267
STRA6 in tissues other than the eye appears to be the coupling of circulating holo-RBP levels to cell signaling, in turn regulating key processes such as insulin response. PMID: 23839944
expression of RBPR2 in liver and fat suggests a possible role in mediating established metabolic actions of RBP4 in those tissues PMID: 23105095
TTR blocks the ability of holo-retinol-binding protein to associate with STRA6 and thereby effectively suppresses both STRA6-mediated retinol uptake and STRA6-initiated cell signaling. PMID: 22826435
Suggest that RBP4 may be involved in the dyslipidemia associated with polycystic ovary syndrome in nonobese adolescents and that there may be an independent relationship between RBP4 and triglycerides but not between RBP4 and insulin resistance. PMID: 22341881
RBP4 is not only an adipocytokine, but also a hepatic cytokine leading to metabolic syndrome, non-alcoholic fatty liver disease and type 2 diabetes. PMID: 21983273
results indicate that rimonabant may improve vascular function by modulating RBP4 along with pro-inflammatory cytokines PMID: 21585349
Basal and cyclic AMP-induced Rbp4 transcription is regulated by a multiprotein complex that is similar to ones that modulate expression of genes of steroid hormone biosynthesis. PMID: 19389484
RBP4 is an adipocyte-derived 'signal' that may contribute to the pathogenesis of type 2 diabetes PMID: 16034410
Lowering transthyretin(TTR) levels or interfering with RBP4-TTR binding may enhance insulin sensitivity in obesity and type 2 diabetes PMID: 18285525
These results reveal a selective effect of all-trans retinoic acid inhibiting RBP4 expression specifically in adipocytes. PMID: 18769064
Identification and characterization of a non-retinoid ligand for retinol-binding protein 4 which lowers serum retinol-binding protein 4 levels in vivo. PMID: 19147488
HMGA1 is an important modulator of RBP4 gene expression in vivo. PMID: 19460132
Although mice lacking HMGA1 are diabetic and express very low levels of the insulin receptor, they have increased insulin sensitivity. Changes in circulating Rbp4 might partly account for this paradox. [REVIEW] PMID: 19664187

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.