Recombinant Mouse ROR1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10076P
Recombinant Mouse ROR1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10076P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9Z139 |
Synonym | dJ537F10.1 Inactive tyrosine protein kinase transmembrane receptor ROR1 MGC99659 Neurotrophic tyrosine kinase Neurotrophic tyrosine kinase receptor related 1 Neurotrophic tyrosine kinase, receptor related 1 NTRKR1 OTTHUMP00000010573 OTTHUMP00000010574 OTTMUSP00000008344 Receptor tyrosine kinase like orphan receptor 1 receptor-related 1 RGD1559469 ROR 1 ROR1 ROR1_HUMAN RP11 24J23.1 Tyrosine kinase like orphan receptor 1 Tyrosine protein kinase transmembrane receptor ROR1 Tyrosine-protein kinase transmembrane receptor ROR1 |
Description | Recombinant Mouse ROR1 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHC KVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYF QCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACA RFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCH YAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKL PNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTK SGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPACDSKDSKEKNKME |
Molecular Weight | 43 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |