Recombinant Mouse SCDGFB/PDGF-D Protein (Tagged)

Name: Recombinant Mouse SCDGFB/PDGF-D Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-1927P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	Q925I7
Synonym	IEGF Iris expressed growth factor Iris-expressed growth factor MGC26867 MSTP036 PDGF D PDGF-D PDGFD PDGFD latent form PDGFD receptor-binding form PDGFD_HUMAN Platelet derived growth factor D Platelet-derived growth factor D receptor-binding form rSCDGF-B SCDGF B SCDGF-B SCDGFB Spinal cord derived growth factor B Spinal cord-derived growth factor B spinal-cord derived growth factor-B protein
Description	Recombinant Mouse SCDGFB/PDGF-D Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	TPQRASIKALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSY PRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVSESS TVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDF QPEAASETNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDL LKHFNPVSWQDDLENLYLDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCT PRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTCSSGKT VKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPR
Molecular Weight	56 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Has oncogenic potential and can induce tumor formation. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.
Subcellular Location	Secreted.
Protein Families	PDGF/VEGF growth factor family
Database References	KEGG: mmu:71785 STRING: 10090.ENSMUSP00000128388 UniGene: Mm.390122
Tissue Specificity	Expressed at high levels in developing heart, lung, kidney and some muscle derivatives. Moderately expressed in liver, brain and testis. In the kidney, localized to glomerular mesangial cells and vascular smooth muscle cells. Up-regulated in areas of rena

Gene Functions References

Data (including data from studies using transgenic/mutant mice and cells from such mice) suggest that Pdgfd promotes cell proliferation, cell migration, and expression of inflammatory factors in adventitial fibroblasts; in obese mice, inhibition of Pdgfd significantly reduces aortic aneurysm formation (induced by infusion of angiotensin II). PMID: 29794241
upregulated in kidney fibrosis, may mediate renal scarring, and is dispensable for normal kidney development and physiological functions PMID: 26924050
Inactivation of the Pdgfd gene resulted in a mild phenotype in C57BL/6 mice, and the offspring was viable, fertile and generally in good health. PMID: 27032083
PDGF-D intensifies fibrogenesis by interfering with the fibrolytic activity of the TIMP-1/MMP-2/MMP-9 system, and PDGF-D signaling is mediated through both PDGF-alpha and -beta receptors. PMID: 25576870
Radial glia require PDGFD-PDGFRbeta signalling in human but not mouse neocortex PMID: 25391964
PDGF D represents a potentially promising target for prostate carcinoma treatment resistance in the absence of PTEN function, and warrants further laboratory evaluation and clinical study. PMID: 24331662
Data indicate that the proteolytic processing of full-length PDGF-D is required for PDGF-D activation of preosteoclasts, and that beta-PDGFR is present in activated osteoclasts. PMID: 22158043
identified PDGF-DD as an important target gene for antiangiogenic therapy due to its pleiotropic effects on vascular and non-vascular cells. PDGF-DD inhibition may offer new therapeutic options to treat neovascular diseases PMID: 20231273
Failure of laminin alpha4-mediated down-regulation of PDGF activity contributes to the progressive renal lesions in this animal model. PMID: 20035058
These results suggest that PDGF-D induce cellular transformation and promote tumour growth by accelerating the proliferation rate of the tumour cells, and by stimulation of tumour neovascularization. PMID: 12629513
splicing variant results in significant differences in peptide expression and function PMID: 12890490
PDGF-D plays an important role in the pathogenesis of tubulointerstitial injury through binding of PDGF-Rbeta in obstructive ureteral nephropathy PMID: 14514732
PDGF-DD, a novel mediator of smooth muscle cell phenotypic modulation, is upregulated in endothelial cells exposed to atherosclerosis-prone flow patterns. PMID: 19028801

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.