Recombinant Mouse Stromal Cell-Derived Factor 1 (CXCL12) Protein (His)

Name: Recombinant Mouse Stromal Cell-Derived Factor 1 (CXCL12) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08342P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Stromal Cell-Derived Factor 1 (CXCL12) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P40224
Target Symbol	CXCL12
Synonyms	Cxcl12; Sdf1; Stromal cell-derived factor 1; SDF-1; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymic lymphoma cell-stimulating factor; TLSF
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Expression Range	22-89aa
Protein Length	Partial
Mol. Weight	12.0kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: mmu:20315 STRING: 10090.ENSMUSP00000072800 UniGene: Mm.303231
Tissue Specificity	Highest expression levels detected in kidney, liver, spleen and muscle. Isoform Alpha is expressed ubiquitously but at varying levels, while isoform Beta displays tissue-specific expression, with expression detected in kidney, liver, heart, spleen and mus

Gene Functions References

superparamagnetic iron oxide nanoparticles also stimulated CXCR4 (C-X-C chemokine receptor type 4) expression and CXCR4-SDF-1 (Stromal cell-derived factor 1) signaling in mesenchymal stem cells. PMID: 29734748
This study regarding high SDF-1 levels in our mouse model of ototoxicity would play a major role in the development of therapeutic agents using MSC homing. PMID: 29430461
CXCL12-CXCR4 signalling is essential for the correct patterning of aortic arches and pulmonary arteries during development. PMID: 29016745
Data (including data from studies in knockout mice) suggest that adipocyte autocrine function involving Sdf1 regulates insulin resistance; Sdf1 gene expression correlates with insulin-desensitized conditions in adipocytes but not other tissues (liver, skeletal muscle); adipocyte-specific ablation of Sdf1 enhances insulin sensitivity in adipose tissues and in whole body. PMID: 29581126
postnatal CXCL12 signaling promotes a specific interneuron circuit that inhibits medial prefrontal cortex activity PMID: 27497284
Study reports that stromal cell-derived factor-1alpha elevated or therapeutically administered in ischemic wounded tissue can stimulate both local endothelial cells (EC) and bone marrow-derived endothelial progenitor cells (EPC) to express reciprocally E-selectin/ligand pairs and thereby enhance EPC-EC interactions. PMID: 27713493
suggest that miR-155 modulates SHIP-1 expression that subsequently affects CXCL12-CXCR4 signaling axis via Akt activation PMID: 28174416
Authors produced recombinant CXCL12 and CXCL12(5-67) and evaluated their effect in murine adult NSCs migration and survival in vitro. We showed CXCL12(5-67) does not promote NSCs migration, but does induce cell death. PMID: 28623786
Study demonstrates that CXCR4/CXCL12 axis can limit oxidative stress injury in hematopoietic stem cells (HSCs) by reducing mitochondrial oxidative stress. CXCL12 has a direct rescue effect on oxidative stress-induced HSC damage at the mitochondrial level. PMID: 27886253
a defect of CXCL12 promoter histone acetylation may represent an additional process participating in CXCL12 expression extinction in colon cancer PMID: 28418886
The structure of murine germinal centers (GC) and the localization of GC B cells are impaired when CXCL12 is unable to bind to cellular or extracellular surfaces. PMID: 28193885
These findings indicate that the CXCL12alpha-CXCR4 axis plays an important role in the regeneration of the neuromuscular junction after motor axon injury. PMID: 28559442
Here, we show that cabozantinib rapidly eradicates invasive, poorly differentiated PTEN/p53-deficient murine prostate cancer. This was associated with enhanced release of neutrophil chemotactic factors from tumor cells, including CXCL12 and HMGB1, resulting in robust infiltration of neutrophils into the tumor. PMID: 28274958
nitration on Tyr7 under inflammatory conditions is a novel natural posttranslational regulatory mechanism of CXCL12 which may downregulate the CXCR4-mediated inflammatory and tumor-promoting activities of CXCL12 PMID: 27566567
SDF-1 is secreted shortly after UPEC infection initiating immune cell accumulation. PMID: 28683322
The data suggest that SDF-1beta provides synergistic effects supporting BMP-2-induced, BMSC-mediated bone formation and appears suitable for optimization of bone augmentation in combination therapy protocols. PMID: 26227988
Hyaluronic acid-laminin hydrogels increase neural stem cell transplant retention and migratory response to SDF-1alpha in a manner critically dependent on signaling via the SDF-1alpha-CXCR4 axis. PMID: 27645115
The Function of SDF-1-CXCR4 Axis in SP Cells-Mediated Protective Role for Renal Ischemia/Reperfusion Injury by SHH/GLI1-ABCG2 Pathway PMID: 27454381
Adora2B stimulation promotes FGF2 and CXCL12 expression in FAP-positive melanoma-associated fibroblasts, contributing to the creation of a tumor-promoting microenvironment. PMID: 27590504
CXCL12 in cardiomyocytes is not involved in cardiac development. * CXCL12 deficiency in cardiomyocytes improves outcome of myocardial infarction. * CXCL12 overexpression in cardiomyocytes worsens outcome of myocardial infarction. * CXCL12 increases fibrosis and invasion of Th1 cells in the heart after infarction. PMID: 27251706
findings suggest that PECAM-1 enhances SDF-1-induced chemotaxis by augmenting and prolonging activation of the PI3K/Akt/mTORC1 pathway and Rap1 and that PECAM-1, at least partly, exerts its activity by inhibiting SDF-1-induced internalization of CXCR4 PMID: 28974577
endothelial CXCR7+ cells regulate CXCL12 gradient direction by controlling concentrations near but not far from the vasculature. PMID: 29117251
This study showed that release of BMP-2 and SDF-1alpha from heparinized MCM scaffolds allows for the reduction of the applied BMP-2 concentration since SDF-1alpha seems to enhance the osteoinductive potential of BMP-2. PMID: 27060915
The results of this study suggested that enhanced interaction between STAT3 and p300 mediated the epigenetic upregulation of CXCL12 in dorsal horn neurons, which contributed to the antitubulin chemotherapeutics-induced persistent pain PMID: 28072604
Dipeptidyl peptidase-4 inhibition, independent of glucagon-like peptide-1 receptor signaling, contributes to protection of the diabetic kidney through SDF-1-dependent antioxidative and antifibrotic effects and amelioration of adverse renal hemodynamics. PMID: 27475229
High Cxcl12 expression is associated with Prostate Cancer. PMID: 28687617
Authors demonstrate that targeting the SDF-1/CXCR4 pathway in the context of KLF10 deletion substantially suppresses PDAC progression PMID: 28581520
Adipocytes promoted osteoclast differentiation, function and expression of adhesion-related molecules through the CXCL12/CXCR4 signalling pathway. PMID: 27868262
these findings demonstrate that expression of Hmga2 cooperates with Jak2(V617F) in the pathogenesis of Mmyelofibrosis. PMID: 28637665
Data demonstrated that sustained expression of CXCL12 by MSCs in the primary tumour site inhibits metastasis through reduction of CXCR7, while, in the presence of TGFbeta, this CXCL12 effect of MSCs on tumour cells is relieved. PMID: 27669436
CXCL12 upregulation prior to stroke onset, and its actions following stroke, contribute to the endogenous, anti-inflammatory phenotype induced by repetitive hypoxic preconditioning PMID: 27006446
Results suggest that SDF-1/CXCR4 signaling plays an important role in the dynamics associated with adult sub-ventricular zone lineage cell proliferation and differentiation. PMID: 27288704
TNF plays an inhibitory role in modulating myocardial SDF-1 production and blockade of TNF signaling by ablation of TNFR1 and TNFR2 genes increased SDF-1 expression in the heart. These data expand on TNF signaling-initiated mechanisms in myocardium, which may lend a more complete understanding of SDF-1 and TNFR-derived actions in hopes of advancing ischemic heart injury treatments. PMID: 27979472
CD26-cleavage skews CXCL12 towards beta-arrestin dependent recruitment through ACKR3 and destroys the CXCR4-mediated lymphocyte chemoattractant properties of CXCL12 in vivo PMID: 28322746
these data highlight AnxA1 as a novel determinant of neutrophil maturation and the mechanisms behind blood neutrophil homing to BM via the CXCL12/CXCR4 pathway. PMID: 26892496
CXCL12/CXCR4 regulates HA and LG following corneal suture placement, and provides a novel strategy to inhibit LG. Notably, the present study is the first to demonstrate evidence that CXCL12/CXCR4 modulates LG in a corneal suture-induced mouse model. PMID: 27121088
the present study indicates that the CXCL12/CXCR4 signaling pathway is important during the development of cochleae in neonatal mice. PMID: 27052602
crosstalk between astrocytic CXCL12 and microglial CXCR4 in the pathogenesis of neuropathic pain. PMID: 27030717
Overexpression of SDF-1alpha could chemotaxize endothelial progenitor cells to reach local wounds, thus further accelerating angiogenesis in the transplant site PMID: 25853481
A model of SDF-1 regulation in the hypoxia pathway was constructed; the underlying mechanisms of SDF-1 kinetics and a novel incoherent feed forward loop regulating SDF-1 expression were proposed. PMID: 26701884
We showed that CXCL12, a potent chemoattractant for CXCR4-expressing NSPCs, was upregulated in the ischemic lesion of N-PRbeta-KO mice. PMID: 26435273
DPP-4 inhibition may have direct protective effects on the post-myocardial infarction heart by inducing an antiapoptotic effect and inhibiting a decrease in vessel number through the SDF-1a/CXCR4-mediated STAT3 signaling pathway. PMID: 26739213
findings demonstrate that Twist-1, which maintains BMSC at an immature state, endows them with an increased capacity for supporting hematopoiesis via direct activation of CXCL12 gene expression. PMID: 26718114
confirm a pivotal role of the SDF-1/CXCR4/CXCR7 axis for chronic allograft vasculopathy development PMID: 26265085
Time-dependent changes in endometrial hypoxia during menstruation correlated with the regulation of mRNAs encoding for the angiogenic genes Vegfa and Cxcl12. PMID: 26780953
The results of this study findings the post-CNS-inflammation role of CXCL12 in augmenting the endogenous myelin/neuronal repair capacity in MS-like disease, likely via CXCL12/CXCR4 autocrine signaling. PMID: 26747276
CXCR4/CXCL12 signaling may control movement of epithelial progenitors from the dental stem cell niche. PMID: 26246398
our present study provided evidence that SDF-1 mediated CSCs migration through CXCR4 and CXCR7 via MEK/ERK and PI3K/Akt pathway PMID: 26578388
Following fracture, a CXCL12(+)-BMP2(+) perivascular cell population is recruited along the endosteum. PMID: 25967044
Data suggest that the conditional chemokine CXCL12 line can be used as a powerful tool to manipulate CXCL12 signaling and function in vivo. PMID: 26505253

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.