Recombinant Mouse TGF beta Receptor II Protein
Beta LifeScience
SKU/CAT #: BLA-1980P
Recombinant Mouse TGF beta Receptor II Protein
Beta LifeScience
SKU/CAT #: BLA-1980P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q62312 |
Synonym | AAT3 FAA3 LDS1B LDS2 LDS2B MFS2 RIIC TAAD2 TbetaR II TbetaR-II TGF beta receptor type 2 TGF beta receptor type II TGF beta receptor type IIB TGF beta type II receptor TGF-beta receptor type II TGF-beta receptor type-2 TGF-beta type II receptor TGF-beta-R2 TGFB R2 TGFbeta - RII TGFbeta RII Tgfbr2 TGFR-2 TGFR2_HUMAN Transforming growth factor beta receptor II Transforming growth factor beta receptor type II Transforming growth factor beta receptor type IIC Transforming growth factor, beta receptor II (70/80kDa) transforming growth factor, beta receptor II alpha transforming growth factor, beta receptor II beta transforming growth factor, beta receptor II delta transforming growth factor, beta receptor II epsilon transforming growth factor, beta receptor II gamma Transforming growth factor-beta receptor type II |
Description | Recombinant Mouse TGF beta Receptor II Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | RVHRQQKLSPSWESSKPRKLMDFSDNCAIILEDDRSDISSTCANNINHNT ELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYSSWKT EKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTR HVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKN DLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENV ESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKD SVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFS ELEHPERLSGRSCSQEKIPEDGSLNTTK |
Molecular Weight | 69 kDa including tags |
Purity | >95% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was determined to be 1.0 nmol/min/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |