Recombinant Mouse TL1A Protein
Beta LifeScience
SKU/CAT #: BLA-2008P
Recombinant Mouse TL1A Protein
Beta LifeScience
SKU/CAT #: BLA-2008P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q5UBV8 |
Synonym | MGC129934 MGC129935 tl1 TL1 A tl1a tnf ligand related molecule 1 TNF ligand-related molecule 1 tnf superfamily ligand tl1a TNF15_HUMAN TNFSF15 Tumor necrosis factor (ligand) superfamily member 15 Tumor necrosis factor ligand superfamily member 15 Tumor necrosis factor ligand superfamily member 15, secreted form Vascular endothelial cell growth inhibitor Vascular endothelial growth inhibitor Vascular endothelial growth inhibitor 192a vegi VEGI192A |
Description | Recombinant Mouse TL1A Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | GKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIP ESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPA RLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKED KTFFGAFLL |
Molecular Weight | 25 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |