Recombinant Mouse TNF Receptor I Protein
Beta LifeScience
SKU/CAT #: BLA-1143P
Recombinant Mouse TNF Receptor I Protein
Beta LifeScience
SKU/CAT #: BLA-1143P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P25118 |
Synonym | CD120a FPF MGC19588 p55 p55-R p60 TBP1 TBPI TNF R TNF R55 TNF-R1 TNF-RI TNFAR TNFR-I TNFR1 TNFR55 TNFR60 TNFRI TNFRSF1a TNR1A_HUMAN Tumor necrosis factor receptor 1 Tumor necrosis factor receptor superfamily, member 1A Tumor necrosis factor receptor type 1 Tumor necrosis factor receptor type I Tumor necrosis factor-binding protein 1 |
Description | Recombinant Mouse TNF Receptor I Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVS DCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQAD KDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHA GFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA |
Molecular Weight | 21 kDa |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. The lyo |