Recombinant Mouse TSLP Protein
Beta LifeScience
SKU/CAT #: BLA-1171P
Recombinant Mouse TSLP Protein
Beta LifeScience
SKU/CAT #: BLA-1171P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9JIE6 |
Synonym | Thymic stromal lymphopoietin Thymic stromal lymphopoietin protein TSLP Tslp TSLP protein TSLP_HUMAN |
Description | Recombinant Mouse TSLP Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEY YTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEV QNICLNQTSQILRLWYSFMQSPE |
Molecular Weight | 14 kDa |
Purity | >99% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The ED50 tested in a Nag8/7 cell proliferation assay was 0.15 ng/ml, corresponding to a specific activity of approximately 6x106 Units/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |