Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active

Beta LifeScience SKU/CAT #: BLC-06020P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active

Beta LifeScience SKU/CAT #: BLC-06020P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml.
Uniprotkb Q9QZM4
Target Symbol TNFRSF10B
Synonyms Tnfrsf10b; Dr5; Killer; Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; MK; CD antigen CD262
Species Mus musculus (Mouse)
Expression System Mammalian cell
Tag C-hFc
Complete Sequence NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Expression Range 53-177aa
Protein Length Partial
Mol. Weight 40.9 kDa
Research Area Cancer
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References
Tissue Specificity Highly expressed in heart, lung and kidney.

Gene Functions References

  1. Death receptor5 pathway and mitochondrial pathway, which are likely mediated by HIF-1alpha, contribute to hypoxia-induced spermatocyte apoptosis. PMID: 28444885
  2. downregulation of cIAPs in PSC cholangiocytes may contribute to the development of the disease. Our results also indicate that inhibition of TRAIL signaling pathways may be beneficial in the treatment of PSC PMID: 28055006
  3. Authors demonstrate, for the first time, expression of TNF-related apoptosis-inducing ligand (TRAIL) and its signaling death receptor 5 (DR5) in the murine inner ear. PMID: 26791792
  4. Malignant transformation in the endometrium is related to reduction of membrane DR4 and DR5 expression. PMID: 23815209
  5. TRAIL expression by osteoclast-like cells is increased in the presence of RANKL and after scraping; DcR2 expression peaks at 24 hours, and and decreases at 5 days; DR5 expression peaks at 5 days PMID: 23430714
  6. Induction of death receptor 5 expression in tumor vasculature by perifosine restores the vascular disruption activity of TRAIL-expressing CD34(+) cells. PMID: 23605004
  7. TRAIL-DR5 interaction promoted malignant behaviors of B16F10 cells. PMID: 23347256
  8. results suggest that the transmembrane domains together with their adjacent stalk regions can play a major role in control of death receptor activation thereby contributing to cell type specific differences in TRAILR1 and TRAILR2 signaling PMID: 22916132
  9. DR5 is selectively expressed by neuroprogenitor cells and newborn neurons. PMID: 21938487
  10. Results suggest that excessive iodine could induce TRAIL and DR5 abnormal expression in thyroid. TRAIL band with DR5 to promote follicular cells apoptosis thus mediate thyroid destruction in EAT. PMID: 21225479
  11. NK cells inhibit dendritic cell cross-priming, but not direct priming, in a TRAIL/DR5-dependent manner. PMID: 21832159
  12. Antibody-based therapy targeting DR5 is an efficient strategy not only to eliminate TRAIL-sensitive tumor cells. PMID: 14769851
  13. presence and function of TRAIL and MK, a death-inducing ligand and its receptor, in mammalian preimplantation embryos. PMID: 15128592
  14. binding of Fas-associated death domain (FADD) to the tumor necrosis factor-related apoptosis-inducing ligand receptor DR5 is regulated by the death effector domain of FADD PMID: 15173180
  15. Inactivation of the TRAIL-R gene did not affect tumorigenesis in the thymus and intestines of p53 knock-out mice and mice mutated in the Adenomatous Polyposis Coli gene, respectively. PMID: 15514675
  16. DR5 has a limited role during embryogenesis and early stages of development but plays an organ-specific role in the response to DNA-damaging stimuli. PMID: 15713653
  17. ceramide acts as a common mediator of caspase-independent programmed cell death caused by death receptors such as mTRAIL-R2 and TNF-R55 PMID: 17026999
  18. These data demonstrate an important role for the TRAIL/DR5/FADD/caspase 8 pathway in the apoptosis associated with skeletal myoblast differentiation. PMID: 17041756
  19. These data represent the first indication that testicular germ cells, specifically spermatocytes, can undergo TRAIL-mediated apoptosis. PMID: 17051329
  20. Thus, sDR5 represents a potential novel therapeutic drug for patients with fulminant hepatitis. PMID: 17126290
  21. cathepsin E plays a substantial role in host defense against tumor cells through TRAIL-dependent apoptosis and/or tumor-associated macrophage-mediated cytotoxicity PMID: 18006832
  22. Thus TRAIL-R may function as an inflammation and tumor suppressor in multiple tissues in vivo. PMID: 18079962
  23. adherent TRAIL-R-expressing skin carcinoma cells were TRAIL resistant in vitro but were sensitized to TRAIL upon detachment by inactivation of the ERK signaling pathway PMID: 18079967
  24. Death receptor 5 mediated-apoptosis contributes to cholestatic liver disease. PMID: 18667695
  25. Apoptosis in experimental non-alcoholic steatohepatitis is associated with p53 activation and TRAIL receptor expression. PMID: 19226377
  26. Data demonstrate that cytokine induced upregulation of TRAIL, DR4 and DR5 in tubules from patients with proliferative lupus nephritis may play a protective role by enhancing survival while also exerting a proinflammatory effect. PMID: 19349211

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed