Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06020P

Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06020P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 10B (TNFRSF10B) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml. |
Uniprotkb | Q9QZM4 |
Target Symbol | TNFRSF10B |
Synonyms | Tnfrsf10b; Dr5; Killer; Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; MK; CD antigen CD262 |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | C-hFc |
Complete Sequence | NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS |
Expression Range | 53-177aa |
Protein Length | Partial |
Mol. Weight | 40.9 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Highly expressed in heart, lung and kidney. |
Gene Functions References
- Death receptor5 pathway and mitochondrial pathway, which are likely mediated by HIF-1alpha, contribute to hypoxia-induced spermatocyte apoptosis. PMID: 28444885
- downregulation of cIAPs in PSC cholangiocytes may contribute to the development of the disease. Our results also indicate that inhibition of TRAIL signaling pathways may be beneficial in the treatment of PSC PMID: 28055006
- Authors demonstrate, for the first time, expression of TNF-related apoptosis-inducing ligand (TRAIL) and its signaling death receptor 5 (DR5) in the murine inner ear. PMID: 26791792
- Malignant transformation in the endometrium is related to reduction of membrane DR4 and DR5 expression. PMID: 23815209
- TRAIL expression by osteoclast-like cells is increased in the presence of RANKL and after scraping; DcR2 expression peaks at 24 hours, and and decreases at 5 days; DR5 expression peaks at 5 days PMID: 23430714
- Induction of death receptor 5 expression in tumor vasculature by perifosine restores the vascular disruption activity of TRAIL-expressing CD34(+) cells. PMID: 23605004
- TRAIL-DR5 interaction promoted malignant behaviors of B16F10 cells. PMID: 23347256
- results suggest that the transmembrane domains together with their adjacent stalk regions can play a major role in control of death receptor activation thereby contributing to cell type specific differences in TRAILR1 and TRAILR2 signaling PMID: 22916132
- DR5 is selectively expressed by neuroprogenitor cells and newborn neurons. PMID: 21938487
- Results suggest that excessive iodine could induce TRAIL and DR5 abnormal expression in thyroid. TRAIL band with DR5 to promote follicular cells apoptosis thus mediate thyroid destruction in EAT. PMID: 21225479
- NK cells inhibit dendritic cell cross-priming, but not direct priming, in a TRAIL/DR5-dependent manner. PMID: 21832159
- Antibody-based therapy targeting DR5 is an efficient strategy not only to eliminate TRAIL-sensitive tumor cells. PMID: 14769851
- presence and function of TRAIL and MK, a death-inducing ligand and its receptor, in mammalian preimplantation embryos. PMID: 15128592
- binding of Fas-associated death domain (FADD) to the tumor necrosis factor-related apoptosis-inducing ligand receptor DR5 is regulated by the death effector domain of FADD PMID: 15173180
- Inactivation of the TRAIL-R gene did not affect tumorigenesis in the thymus and intestines of p53 knock-out mice and mice mutated in the Adenomatous Polyposis Coli gene, respectively. PMID: 15514675
- DR5 has a limited role during embryogenesis and early stages of development but plays an organ-specific role in the response to DNA-damaging stimuli. PMID: 15713653
- ceramide acts as a common mediator of caspase-independent programmed cell death caused by death receptors such as mTRAIL-R2 and TNF-R55 PMID: 17026999
- These data demonstrate an important role for the TRAIL/DR5/FADD/caspase 8 pathway in the apoptosis associated with skeletal myoblast differentiation. PMID: 17041756
- These data represent the first indication that testicular germ cells, specifically spermatocytes, can undergo TRAIL-mediated apoptosis. PMID: 17051329
- Thus, sDR5 represents a potential novel therapeutic drug for patients with fulminant hepatitis. PMID: 17126290
- cathepsin E plays a substantial role in host defense against tumor cells through TRAIL-dependent apoptosis and/or tumor-associated macrophage-mediated cytotoxicity PMID: 18006832
- Thus TRAIL-R may function as an inflammation and tumor suppressor in multiple tissues in vivo. PMID: 18079962
- adherent TRAIL-R-expressing skin carcinoma cells were TRAIL resistant in vitro but were sensitized to TRAIL upon detachment by inactivation of the ERK signaling pathway PMID: 18079967
- Death receptor 5 mediated-apoptosis contributes to cholestatic liver disease. PMID: 18667695
- Apoptosis in experimental non-alcoholic steatohepatitis is associated with p53 activation and TRAIL receptor expression. PMID: 19226377
- Data demonstrate that cytokine induced upregulation of TRAIL, DR4 and DR5 in tubules from patients with proliferative lupus nephritis may play a protective role by enhancing survival while also exerting a proinflammatory effect. PMID: 19349211