Recombinant Mouse Tumor Necrosis Factor (TNF) Protein (His-SUMO)

Name: Recombinant Mouse Tumor Necrosis Factor (TNF) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09445P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Tumor Necrosis Factor (TNF) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P06804
Target Symbol	TNF
Synonyms	Tnf; Tnfa; Tnfsf2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF); Intracellular domain 1; ICD1); Intracellular domain 2; ICD2); C-domain 1; C-domain 2; Tumor necrosis factor; soluble form]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Expression Range	57-235aa
Protein Length	Extracellular Domain
Mol. Weight	35.7kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.
Protein Families	Tumor necrosis factor family
Database References	KEGG: mmu:21926 STRING: 10090.ENSMUSP00000025263 UniGene: Mm.1293

Gene Functions References

Following Unfolded Protein Response activation during autosomal dominant retinitis pigmentosa progression, secrete TNFalpha and signal a self-destructive program to the cones, resulting in their cell death. PMID: 27750040
In a hypercaloric environment, persistent elevation of microglial reactivity and consequent TNFalpha secretion induces mitochondrial stress in POMC neurons that contributes to the development of obesity. Specific disruption of the gene expressions of TNFalpha downstream signals TNFSF11A or NDUFAB1 in the mediobasal hypothalamus of diet-induced obese mice reverses mitochondrial elongation and reduces obesity. PMID: 28489068
persistent stimulation with titanium particles may lead to a consistent release of TNF-alpha and IL-6 via SPHK-2 activity, which may lead to aseptic implant loosening PMID: 29728804
Recognition memory improved with exercise in WT mice, was impaired in TNFR1(-/-) exercise mice, showed non-significant impairment with exercise in TNF(-/-) mice, and no changes in TNFR2(-/-) mice. In spatial learning there were exercise related improvements in WT mice, non-significant but meaningful impairments evident in TNFR1(-/-) exercise mice, modest improvement in TNF(-/-) exercise mice. PMID: 29969604
In vitro mild uncoupling rescued from TNF-induced endothelial permeability, disassembly of cell contacts and VE-cadherin cleavage by the matrix metalloprotease 9 (capital EM, Cyrilliccapital EM, Cyrilliccapital ER, Cyrillic9). The uncouplers prevented TNF-induced expression of MMP9 via inhibition of NFkappaB signaling. PMID: 28131916
macrophage-TNF-induced AKT/beta-catenin signalling in Lgr5(+) hair follicle stem cells has a crucial role in promoting hair follicle cycling and neogenesis after wounding PMID: 28345588
Transmembrane TNF, TNFR2 and TNFR1 (indirectly) are critical for preventing inflammation during BCG-induced pleurisy in mice. PMID: 29973541
findings demonstrate a new role for TNFalpha as a key regulator of neutrophil trafficking into and within lymphatic system in vivo. PMID: 28287124
Our work suggested that TNF-alpha and TNF-R1 are the major contributors of TNF signaling pathway in anesthesia-induced spinal cord neurotoxicity. Targeting TNF-alpha / TNF-R1, not TNF-R2 signaling pathway may be the key component to rescue or prevent anesthesia-induced apoptotic injury in spinal cord neurons. PMID: 29802833
observation from the present research work reveals that Quercetin suppressed the production of proinflammatory cytokines at different levels, such as TNF-alpha and IL-1beta, and inhibits the activation of I-kappaB phosphorylation, whereas the total content was not affected. PMID: 29322353
this is the first evidence to suggest that TET2 mutations promote clonal dominance with aging by conferring TNFalpha resistance to sensitive bone marrow progenitors while also propagating such an inflammatory environment. PMID: 29195897
Elevated A20 promotes TNF-induced and RIPK1-dependent intestinal epithelial cell death PMID: 30209212
M. tuberculosis and TNFalpha synergise to induce necroptosis in murine fibroblasts via RIPK1-dependent mechanisms and characterized by phosphorylation of Ser345 of the MLKL necroptosis death effector. PMID: 28892415
Our current study has demonstrated that in allergic airway disease (AAD) mice, intestinal dysbiosis (ID) caused increased nasal rubbing, sneezing, serum OVA specific IgE level and pro-inflammatory cytokine TNF-alpha in NALF and BALF. ID also inhibited miR-130a expression in AAD mice. Further molecular experiments indicated that miR-130a could specifically target and repress TNF-alpha mRNA expression. PMID: 29702281
These data may indicate that insulin resistance in Adp(-/-) mice is likely caused by an increase in concentrations of TNFalpha and FFA via downregulation of PPARalpha. PMID: 29445073
TNF-alpha is involved in cardiac PHLPP1 upregulation during reoxygenation, which is mediated by NF-kappaB transcriptional activity PMID: 29940243
Lack of TNF-alpha signaling through Tnfr1 makes the mice more susceptible to acute infection but does not alter state of latency and reactivation of HSV-1. PMID: 29113822
although TNFalpha does not induce osteoclastogenesis alone, it does work with RANKL to induce osteoclastic differentiation, and the NFkappaB pathway may serve an important role in this process. PMID: 29512766
two different modes of necroptosis induction by TNFalpha exist which are differentially regulated by iuRIPK1 formation. Overall, this work reveals a distinct mechanism of RIPK1 activation that mediates the signaling mechanism of RDA as well as a type of necroptosis. PMID: 29891719
Results demonstrate a critical role for the TRPM2 channel in Abeta42-induced microglial activation and generation of TNF-alpha: PKC/NOX-mediated generation of ROS and activation of PARP-1 are required for Abeta42-induced TRPM2 channel activation and, furthermore, the PYK2/MEK/ERK signaling pathway as a positive feedback mechanism downstream of TRPM2 channel activation facilitates further activation of PARP-1 and TRPM2 ... PMID: 29143372
TNFalpha may act reciprocally with DRA, leading to the development of intestinal inflammation. PMID: 29286110
TNF-alpha plays a pivotal role in the development of nonalcoholic fatty liver disease and progression to nonalcoholic steatohepatitis. PMID: 28922680
Cross-fostering and conditional knockout experiments indicated that a TNF-alpha deficit in the maternal brain, rather than in the hematopoietic system, and during gestation was responsible for the low-fear offspring phenotype. PMID: 29199072
In a retinitis pigmentosa mouse model, TrkC activity generates phosphorylated Erk, which upregulates glial TNF-alpha, causing selective neuronal death. PMID: 29242588
genome-wide knockdown of 19 ribosomal proteins resulted in decreased IL-10 and increased TNF-alpha production. PMID: 29657255
We conclude that one of the possible regulatory mechanisms of TNF in mechanical orofacial hyperalgesia involves upregulation of the nociceptor TRPV1 PMID: 29132095
The work highlighted the modulatory role of miR-105 in TNF-alpha-induced epithelial-mesenchymal transition and promoting colorectal cancer metastasis. PMID: 29238068
These results suggest that glucocorticoids' effects on adipose tissue immune response, both in a pro- and an anti-inflammatory manner, depend on the nutritional status. PMID: 29847081
This study demonstrated that TNF-alpha genetic deletion ameliorates the amyloid phenotype of the 5XFAD mouse model of AD. 5XFAD/TNF-alpha-/- mice exhibit significantly decreased amyloid deposition and reduced levels of AbetaPP-CTFs and amyloid-beta protein. PMID: 28826177
Data suggest that expression of Tnfa in adipocytes can be regulated by dietary fatty acids; here, polyunsaturated fatty acids regulate Tnfa expression via alteration in methylation of Tnfa promoter in rats fed polyunsaturated fatty acids (safflower oil versus coconut/olive oil) and in mouse adipocyte cell line incubated with polyunsaturated fatty acid (linoleic acid versus palmitic/oleic acids). PMID: 28575756
a precise mechanism for attenuation of HgCl2-induced liver dysfunction by dietary luteolin via regulating Sirt1/Nrf2/TNF-alpha signaling pathway, and provide a foundation for further study of luteolin as a novel therapeutic agent against inorganic mercury poisoning. PMID: 27853236
a significant increase in plasma levels of IL-2, IFN-g and TNF-a was revealed as assessed by ELISA. In conclusion, the results of the present study indicate that MENK has a cytotoxic effect on B16 melanoma cells in vitro and in vivo, and suggest a potential mechanism for these bioactivities. PMID: 28849104
findings suggest that PGRN deficiency leads to excessive NF-kappaB activation in microglia and elevated TNFalpha signaling, which in turn lead to hyperexcitability of medium spiny neurons and obsessive-compulsive behavior-like behavior. PMID: 28438992
findings highlight an epigenetic mechanism by which EZH2 integrates the multifaceted effects of TNFalpha signaling to promote the inflammatory response and apoptosis in colitis. PMID: 28439030
It is possible that JNK and TNF-alpha commonly contribute to kidney damage by assembling a positive feedback cycle after crush syndrome, leading to increased apoptosis in the renal cortex. HMGB1 from the muscle may be the trigger. PMID: 28701229
Cytokine-inducing and anti-inflammatory activity of chitosan and its low-molecular derivative. PMID: 29513410
Excessive death of hepatocytes is a characteristic of liver injury. A new programmed cell death pathway has been described involving upstream death ligands such as TNF and downstream kinases such as RIPK1. PMID: 28088582
Taken together, we have demonstrated a role for TNF in the development of classically activated macrophages in listeriosis PMID: 28545808
Inhibition of signaling stimulated by both TNF and IL1beta synergizes with NF-kappaB inhibition in eliminating leukemic stem cells. PMID: 28039479
Calyptranthes grandifolia O.Berg (Myrtaceae) ethanolic extract inhibits TNF-alpha gene expression and cytokine release in vitro PMID: 28447740
Results show that interleukin 6 (IL6) promotes oval cell proliferation and liver regeneration, while tumor necrosis factor alpha (TNFalpha) and TNF receptor-1(TNFR1) do not affect this process. PMID: 27556180
This study adds to the evidence that both peripheral and brain region-specific increases in tumor necrosis factor alpha lead to both sickness and depression- and anxiety disorder-relevant behavior and do so via different pathways. PMID: 27515532
Lactosylceramide-Induced Phosphorylation Signaling to Group IVA Phospholipase A2 via Reactive Oxygen Species in Tumor Necrosis Factor-alpha-Treated Cells. PMID: 28444900
The current study demonstrated that honey can stimulate or suppress the mRNA expression of some pro-inflammatory cytokines in mice brains. Furthermore, honey suppresses the TNF-alpha mRNA expression in the presence of T. gondii infection but it stimulates the IL-1beta and IL-6 mRNA expression. Treatment of the mice with honey reduces parasite multiplication in the brain. PMID: 27591508
aerobic interval training enhanced the anti-inflammatory indices IL-10/TNF-alpha ratio and IL-15 expression in skeletal muscle in tumor-bearing mice. PMID: 27863332
findings suggest that activation of Tnf-Aicda axis and co-inhibitory signals to T cells in coordination with Th1-type immunity has critical roles in the immune response against Hepatitis B virus infection PMID: 28063995
Taken together, we speculate that DT-13 inhibits endothelium vascular inflammation through regulating nitric oxide production and the expression of ROS, TNFR, IL-8, MCP-1, which are associated with inflammation. PMID: 29162452
TNF signalling is required for the expansion and differentiation of pathogenic IFNgamma+CD4+ T cells that promote the irreversible loss of bone marrow function. PMID: 28671989
Drugs targeting XIAP and cIAP1/2 may be effective for osteosarcoma patients whose tumors express abundant RIPK1 and contain high levels of TNFalpha. PMID: 27129149
Taken together, we indicated that anti-IL-6 and anti-TNF-alpha therapy prevent intestinal permeability induced by intestinal inflammation PMID: 27155817

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.