Recombinant Mouse TWEAKR/FN14 Protein
Beta LifeScience
SKU/CAT #: BLA-10150P
Recombinant Mouse TWEAKR/FN14 Protein
Beta LifeScience
SKU/CAT #: BLA-10150P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9CR75 |
Synonym | CD 266 CD266 CD266 antigen FGF inducible 14 FGF-inducible 14 Fibroblast growth factor inducible immediate early response protein 14 Fibroblast growth factor-inducible immediate-early response protein 14 FN 14 FN14 TNFRSF 12A TNFRSF12A TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A TWEAK R Tweak receptor Tweak-receptor TweakR |
Description | Recombinant Mouse TWEAKR/FN14 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM DCASCPARPHSDFCLGCAAAPPAHF |
Molecular Weight | 34 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Binds Human and mouse TWEAK.Inhibits TWEAK-mediated killing of Kym-1 target cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |